KEGG   Homo sapiens (human): 1979Help
Entry
1979              CDS       T01001                                 

Gene name
EIF4EBP2, 4EBP2, PHASII
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 2
  KO
K18644  
eukaryotic translation initiation factor 4E binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1979 (EIF4EBP2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    1979 (EIF4EBP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1979 (EIF4EBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q21-q22
AA seq 120 aa AA seqDB search
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLL
DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtcagccggcagcggccaccagcccagccagagccgcgccatccccacccgc
accgtggccatcagcgacgccgcgcagctacctcatgactattgcaccacgcccgggggg
acgctcttctccaccacaccgggaggaactcgaatcatttatgacagaaagtttctgttg
gatcgtcgcaattctcccatggctcagaccccaccctgccacctgcccaatatcccagga
gtcactagccctggcaccttaattgaagactccaaagtagaagtaaacaatttgaacaac
ttgaacaatcacgacaggaaacatgcagttggggatgatgctcagttcgagatggacatc
tga

DBGET integrated database retrieval system