KEGG   Homo sapiens (human): 1982Help
Entry
1982              CDS       T01001                                 

Gene name
EIF4G2, AAG1, DAP5, NAT1, P97
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma 2
  KO
K03260  
translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Viral myocarditis
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1982 (EIF4G2)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    1982 (EIF4G2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1982 (EIF4G2)
   mRNA cycle factors
    Stress granule specific factors
     1982 (EIF4G2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1982 (EIF4G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15
AA seq 907 aa AA seqDB search
MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDD
NSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVD
KALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTR
NVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKK
RVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPR
MKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS
QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSF
LMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPS
KEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKA
SSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISE
LAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILE
GKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYI
SSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN
SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEE
ESEEEAD
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtggagagtgcgattgcagaagggggtgcttctcgtttcagtgcttcttcgggcggagga
ggaagtaggggtgcacctcagcactatcccaagactgctggcaacagcgagttcctgggg
aaaaccccagggcaaaacgctcagaaatggattcctgcacgaagcactagacgagatgac
aactccgcagcaaacaactccgcaaacgaaaaagaacgacatgatgcaatcttcaggaaa
gtaagaggcatactaaataagcttactcctgaaaagtttgacaagctatgccttgagctc
ctcaatgtgggtgtagagtctaaactcatccttaaaggggtcatactgctgattgtggac
aaagccctagaagagccaaagtatagctcactgtatgctcagctatgtctgcgattggca
gaagatgcaccaaactttgatggcccagcagcagagggtcaaccaggacagaagcaaagc
accacattcagacgcctcctaatttccaaattacaagatgaatttgaaaaccgaactaga
aatgttgatgtctatgataagcgtgaaaatcccctcctccccgaggaggaggaacagaga
gccattgctaagatcaagatgttgggaaacatcaaattcattggagagcttggcaagctt
gatcttattcacgaatctatccttcataagtgcatcaaaacacttttggaaaagaagaag
agagtccaactcaaagatatgggagaggatttggagtgcctctgtcagataatgaggaca
gtgggacctagattagaccatgaacgagccaagtccttaatggatcagtactttgcccga
atgtgctccttgatgttaagtaaggaattgccagcaaggattcgtttcctgctgcaggat
accgtagagttgcgagaacaccattgggttcctcgcaaggcttttcttgacaatggacca
aagacgatcaatcaaattcgtcaagatgcagtaaaagatctaggggtgtttattcctgct
cctatggctcaagggatgagaagtgacttctttctggagggaccgttcatgccacccagg
atgaaaatggatagggacccacttggaggacttgctgatatgtttggacaaatgccaggt
agcggaattggtactggtccaggagttatccaggatagattttcacccaccatgggacgt
catcgttcaaatcaactcttcaatggccatgggggacacatcatgcctcccacacaatcg
cagtttggagagatgggaggcaagtttatgaaaagccaggggctaagccagctctaccat
aaccagagtcagggactcttatcccagctgcaaggacagtcgaaggatatgccacctcgg
ttttctaagaaaggacagcttaatgcagatgagattagcctgaggcctgctcagtcgttc
ctaatgaataaaaatcaagtgccaaagcttcagccccagataactatgattcctcctagt
gcacaaccaccacgcactcaaacaccacctctgggacagacacctcagcttggtctcaaa
actaatccaccgcttatccaggaaaagcctgccaagaccagcaaaaagccaccaccgtca
aaggaagaactccttaaactaactgaaactgttgtgactgaatatctaaatagtggaaat
gcaaatgaggctgtcaatggtgtaagagaaatgagggctcctaaacactttcttcctgag
atgttaagcaaagtaatcatcctgtcactagatagaagcgatgaagataaagaaaaagca
agttctttgatcagtttactcaaacaggaagggatagccacaagtgacaacttcatgcag
gctttcctgaatgtattggaccagtgtcccaaactggaggttgacatccctttggtgaaa
tcctatttagcacagtttgcagctcgtgccatcatttcagagctggtgagcatttcagaa
ctagctcaaccactagaaagtggcacccattttcctctcttcctactttgtcttcagcag
ttagctaaattacaagatcgagaatggttaacagaactttttcaacaaagcaaggtcaat
atgcagaaaatgctcccagaaattgatcagaataaggaccgcatgttggagattttggaa
ggaaagggactgagtttcttattcccactcctcaaattggagaaggaactgttgaagcaa
ataaagttggatccatcccctcaaaccatatataaatggattaaagataacatctctccc
aaacttcatgtagataaaggatttgtgaacatcttaatgactagcttcttacagtacatt
tctagtgaagtaaacccccccagcgatgaaacagattcatcctctgctccttccaaagaa
cagttagagcaggaaaaacaactactactatctttcaagccagtaatgcagaaatttctt
catgatcacgttgatctacaagtcagtgccctgtatgctctccaggtgcactgctataac
agcaacttcccaaaaggcatgttacttcgcttttttgtgcacttctatgacatggaaatt
attgaagaagaagctttcttggcttggaaagaagatataacccaagagtttccgggaaaa
ggcaaggctttgttccaggtgaatcagtggctaacctggttagaaactgctgaagaagaa
gaatcagaggaagaagctgactaa

DBGET integrated database retrieval system