KEGG   Homo sapiens (human): 1990Help
Entry
1990              CDS       T01001                                 

Gene name
CELA1, ELA1
Definition
(RefSeq) chymotrypsin like elastase family member 1 (EC:3.4.21.36)
  KO
K01326  
pancreatic elastase I [EC:3.4.21.36]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.36  pancreatic elastase
     1990 (CELA1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1990 (CELA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 258 aa AA seqDB search
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMT
AAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQS
VTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSS
YWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTV
FTQVSAYISWINNVIASN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcctttatggacacagcacccaggaccttccggaaaccaatgcccgcgtagtc
ggagggactgaggccgggaggaattcctggccctctcagatttccctccagtaccggtct
ggaggttcccggtatcacacctgtggagggacccttatcagacagaactgggtgatgaca
gctgctcactgcgtggattaccagaagactttccgcgtggtggctggagaccataacctg
agccagaatgatggcactgagcagtacgtgagtgtgcagaagatcgtggtgcatccatac
tggaacagcgataacgtggctgccggctatgacatcgccctgctgcgcctggcccagagc
gttaccctcaatagctatgtccagctgggtgttctgccccaggagggagccatcctggct
aacaacagtccctgctacatcacaggctggggcaagaccaagaccaatgggcagctggcc
cagaccctgcagcaggcttacctgccctctgtggactacgccatctgctccagctcctcc
tactggggctccactgtgaagaacaccatggtgtgtgctggtggagatggagttcgctct
ggatgccagggtgactctgggggccccctccattgcttggtgaatggcaagtattctgtc
catggagtgaccagctttgtgtccagccggggctgtaatgtctccaggaagcctacagtc
ttcacccaggtctctgcttacatctcctggataaataatgtcatcgcctccaactga

DBGET integrated database retrieval system