KEGG   Homo sapiens (human): 1992Help
Entry
1992              CDS       T01001                                 

Gene name
SERPINB1, EI, ELANH2, HEL-S-27, HEL57, LEI, M/NEI, MNEI, PI-2, PI2
Definition
(RefSeq) serpin family B member 1
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    1992 (SERPINB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 1992
NCBI-ProteinID: NP_109591
OMIM: 130135
HGNC: 3311
Ensembl: ENSG00000021355
Vega: OTTHUMG00000014124
Pharos: P30740(Tbio)
UniProt: P30740 V9HWH1
Structure
PDB: 

Jmol
Position
6p25.2
AA seq 379 aa AA seqDB search
MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF
NTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD
FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT
TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDES
TGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLF
FIRHNSSGSILFLGRFSSP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctgagctcagcaaacacccgcttcgccttggacctgttcctggcgttgagt
gagaacaatccggctggaaacatcttcatctctcccttcagcatttcatctgctatggcc
atggtttttctggggaccagaggtaacacggcagcacagctgtccaagactttccatttc
aacacggttgaagaggttcattcaagattccagagtctgaatgctgatatcaacaaacgt
ggagcgtcttatattctgaaacttgctaatagattatatggagagaaaacttacaatttc
cttcctgagttcttggtttcgactcagaaaacatatggtgctgacctggccagtgtggat
tttcagcatgcctctgaagatgcaaggaagaccataaaccagtgggtcaaaggacagaca
gaaggaaaaattccggaactgttggcttcgggcatggttgataacatgaccaaacttgtg
ctagtaaatgccatctatttcaagggaaactggaaggataaattcatgaaagaagccacg
acgaatgcaccattcagattgaataagaaagacagaaaaactgtgaaaatgatgtatcag
aagaaaaaatttgcatatggctacatcgaggaccttaagtgccgtgtgctggaactgcct
taccaaggcgaggagctcagcatggtcatcctgctgccggatgacattgaggacgagtcc
acgggcctgaagaagattgaggaacagttgactttggaaaagttgcatgagtggactaaa
cctgagaatctcgatttcattgaagttaatgtcagcttgcccaggttcaaactggaagag
agttacactctcaactccgacctcgcccgcctaggtgtgcaggatctctttaacagtagc
aaggctgatctgtctggcatgtcaggagccagagatatttttatatcaaaaattgtccac
aagtcatttgtggaagtgaatgaagagggaacagaggcggcagctgccacagcaggcatc
gcaactttctgcatgttgatgcccgaagaaaatttcactgccgaccatccattccttttc
tttattcggcataattcctcaggtagcatcctattcttggggagattttcttccccttag

DBGET integrated database retrieval system