KEGG   Homo sapiens (human): 1992Help
Entry
1992              CDS       T01001                                 

Gene name
SERPINB1, EI, ELANH2, HEL57, LEI, M/NEI, MNEI, PI-2, PI2
Definition
serpin peptidase inhibitor, clade B (ovalbumin), member 1
Orthology
K13963  
serpin B
Organism
hsa  Homo sapiens (human)
Pathway
Amoebiasis
Class
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25
AA seq 379 aa AA seqDB search
MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF
NTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD
FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT
TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDES
TGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLF
FIRHNSSGSILFLGRFSSP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctgagctcagcaaacacccgcttcgccttggacctgttcctggcgttgagt
gagaacaatccggctggaaacatcttcatctctcccttcagcatttcatctgctatggcc
atggtttttctggggaccagaggtaacacggcagcacagctgtccaagactttccatttc
aacacggttgaagaggttcattcaagattccagagtctgaatgctgatatcaacaaacgt
ggagcgtcttatattctgaaacttgctaatagattatatggagagaaaacttacaatttc
cttcctgagttcttggtttcgactcagaaaacatatggtgctgacctggccagtgtggat
tttcagcatgcctctgaagatgcaaggaagaccataaaccagtgggtcaaaggacagaca
gaaggaaaaattccggaactgttggcttcgggcatggttgataacatgaccaaacttgtg
ctagtaaatgccatctatttcaagggaaactggaaggataaattcatgaaagaagccacg
acgaatgcaccattcagattgaataagaaagacagaaaaactgtgaaaatgatgtatcag
aagaaaaaatttgcatatggctacatcgaggaccttaagtgccgtgtgctggaactgcct
taccaaggcgaggagctcagcatggtcatcctgctgccggatgacattgaggacgagtcc
acgggcctgaagaagattgaggaacagttgactttggaaaagttgcatgagtggactaaa
cctgagaatctcgatttcattgaagttaatgtcagcttgcccaggttcaaactggaagag
agttacactctcaactccgacctcgcccgcctaggtgtgcaggatctctttaacagtagc
aaggctgatctgtctggcatgtcaggagccagagatatttttatatcaaaaattgtccac
aagtcatttgtggaagtgaatgaagagggaacagaggcggcagctgccacagcaggcatc
gcaactttctgcatgttgatgcccgaagaaaatttcactgccgaccatccattccttttc
tttattcggcataattcctcaggtagcatcctattcttggggagattttcttccccttag

DBGET integrated database retrieval system