KEGG   Homo sapiens (human): 1997Help
Entry
1997              CDS       T01001                                 

Gene name
ELF1
Definition
E74-like factor 1 (ets domain transcription factor)
Orthology
K09428  
E74-like factor 1/2/4
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    1997 (ELF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q13
AA seq 595 aa AA seqDB search
MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDM
ITESSLDVAEEEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRI
NGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGK
GNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETM
GRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSATSNRN
QTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFR
TVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQLHTVTLQ
TVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQKAGSPPSIVLGPAQV
QQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQETKT
LTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPNSF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttgtccaacagaacgacctagtatttgaatttgctagtaacgtcatggag
gatgaacgacagcttggtgatccagctatttttcctgccgtaattgtggaacatgttcct
ggtgctgatattctcaatagttatgccggtctagcctgtgtggaagagcccaatgacatg
attactgagagttcactggatgttgctgaagaagaaatcatagacgatgatgatgatgac
atcacccttacagttgaagcttcttgtcatgacggggatgaaacaattgaaactattgag
gctgctgaggcactcctcaatatggattcccctggccctatgctggatgaaaaacgaata
aatgggattcctgaagtgatggaaacacagcaggtgcaagaaaaatatgcagactcaccg
ggagcctcatcaccagaacagcctaagaggaaaaaaggaagaaaaactaaaccaccacga
ccagattccccagccactacgccaaatatatctgtgaagaagaaaaacaaagatggaaag
ggaaacacaatttatctttgggagtttttactggcactgctccaggacaaggctacttgt
cctaaatacatcaagtggacccagcgagagaaaggcatttttaaattggtggattctaaa
gcagtgtccaggttgtgggggaagcacaaaaacaaacctgatatgaattatgagaccatg
ggaagagcactcaggtactattaccaaaggggtattctggcaaaagtggaaggtcagcgc
ttggtgtatcagtttaaagaaatgccaaaagatcttatatatataaatgatgaggatcca
agttccagcatagagtcttcagatccatcgctatcttcatcagccacttcaaataggaat
caaaccagccggtcgagagtatcttcaagtccaggggtaaaaggaggagccactacagtt
ctaaaaccagggaattctaaagctgcaaaacccaaagatcctgtggaagttgcacaacca
tcagaagttttgaggacagtgcagcccacgcagtctccatatcctacccagctcttccgg
actgttcatgtagtacagccagtacaggctgtcccagagggagaagcagctagaaccagt
accatgcaggatgaaacattaaattcttccgttcagagtattaggactatacaggctcca
acccaagttccagtggttgtgtctcctaggaatcagcagttgcatacagtaacactccaa
acagtgccactcacaacagttatagccagcacagatccatcagcaggtactggatctcag
aagtttattttacaagccattccatcatcacagcccatgacagtactgaaagaaaatgtc
atgctgcagtcacaaaaggcgggctctcctccttcaattgtcttgggccctgcccaggtt
cagcaggtccttactagcaatgttcagaccatttgcaatggaaccgtcagtgtggcttcc
tctccatccttcagtgctactgcacctgtggtgaccttttctcctcgcagttcacagctg
gttgctcacccacctggcactgtaatcacttcagttatcaaaactcaagaaacaaaaact
cttacacaggaagtagagaaaaaggaatctgaagatcatttgaaagagaacactgagaaa
acggagcagcagccacagccttatgtgatggtagtgtccagttccaatggatttacttct
caggtagctatgaaacaaaacgaactgctggaacccaactctttttag

DBGET integrated database retrieval system