KEGG   Homo sapiens (human): 199974Help
Entry
199974            CDS       T01001                                 

Gene name
CYP4Z1, CYP4A20
Definition
cytochrome P450, family 4, subfamily Z, polypeptide 1 (EC:1.14.14.1)
Orthology
K07429  
cytochrome P450, family 4, subfamily Z [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     199974 (CYP4Z1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   199974 (CYP4Z1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33
AA seq 505 aa AA seqDB search
MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEF
YPVKEFEVYHKLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESW
VGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELF
QHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFS
SQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDFS
EADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSSITWEHLS
QMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED
PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHS
RPPQPVRQVVLKSKNGIHVFAKKVC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagccctcctggcttcaggaactcatggctcaccccttcttgctgctgatcctcctc
tgcatgtctctgctgctgtttcaggtaatcaggttgtaccagaggaggagatggatgatc
agagccctgcacctgtttcctgcaccccctgcccactggttctatggccacaaggagttt
tacccagtaaaggagtttgaggtgtatcataagctgatggaaaaatacccatgtgctgtt
cccttgtgggttggaccctttacgatgttcttcagtgtccatgacccagactatgccaag
attctcctgaaaagacaagatcccaaaagtgctgttagccacaaaatccttgaatcctgg
gttggtcgaggacttgtgaccctggatggttctaaatggaaaaagcaccgccagattgtg
aaacctggcttcaacatcagcattctgaaaatattcatcaccatgatgtctgagagtgtt
cggatgatgctgaacaaatgggaggaacacattgcccaaaactcacgtctggagctcttt
caacatgtctccctgatgaccctggacagcatcatgaagtgtgccttcagccaccagggc
agcatccagttggacagtaccctggactcatacctgaaagcagtgttcaaccttagcaaa
atctccaaccagcgcatgaacaattttctacatcacaacgacctggttttcaaattcagc
tctcaaggccaaatcttttctaaatttaaccaagaacttcatcagttcacagagaaagta
atccaggaccggaaggagtctcttaaggataagctaaaacaagatactactcagaaaagg
cgctgggattttctggacatacttttgagtgccaaaagcgaaaacaccaaagatttctct
gaagcagatctccaggctgaagtgaaaacgttcatgtttgcaggacatgacaccacatcc
agtgctatctcctggatcctttactgcttggcaaagtaccctgagcatcagcagagatgc
cgagatgaaatcagggaactcctaggggatgggtcttctattacctgggaacacctgagc
cagatgccttacaccacgatgtgcatcaaggaatgcctccgcctctacgcaccggtagta
aacatatcccggttactcgacaaacccatcacctttccagatggacgctccttacctgca
ggaataactgtgtttatcaatatttgggctcttcaccacaacccctatttctgggaagac
cctcaggtctttaaccccttgagattctccagggaaaattctgaaaaaatacatccctat
gccttcataccattctcagctggattaaggaactgcattgggcagcattttgccataatt
gagtgtaaagtggcagtggcattaactctgctccgcttcaagctggctccagaccactca
aggcctccccagcctgttcgtcaagttgtcctcaagtccaagaatggaatccatgtgttt
gcaaaaaaagtttgctaa

DBGET integrated database retrieval system