KEGG   Homo sapiens (human): 20Help
Entry
20                CDS       T01001                                 

Gene name
ABCA2, ABC2
Definition
ATP-binding cassette, sub-family A (ABC1), member 2
Orthology
K05642  
ATP-binding cassette, subfamily A (ABC1), member 2
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    20 (ABCA2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    20 (ABCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 2436 aa AA seqDB search
MGFLHQLQLLLWKNVTLKRRSPWVLAFEIFIPLVLFFILLGLRQKKPTISVKEVSFYTAA
PLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSE
LEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSVARNPQELWRFLTQNLSLPNSTAQAL
LAARVDPPEVYHLLFGPSSALDSQSGLHKGQEPWSRLGGNPLFRMEELLLAPALLEQLTC
TPGSGELGRILTVPESQKGALQGYRDAVCSGQAAARARRFSGLSAELRNQLDVAKVSQQL
GLDAPNGSDSSPQAPPPRRLQALLGDLLDAQKVLQDVDVLSALALLLPQGACTGRTPGPP
ASGAGGAANGTGAGAVMGPNATAEEGAPSAAALATPDTLQGQCSAFVQLWAGLQPILCGN
NRTIEPEALRRGNMSSLGFTSKEQRNLGLLVHLMTSNPKILYAPAGSEVDRVILKANETF
AFVGNVTHYAQVWLNISAEIRSFLEQGRLQQHLRWLQQYVAELRLHPEALNLSLDELPPA
LRQDNFSLPSGMALLQQLDTIDNAACGWIQFMSKVSVDIFKGFPDEESIVNYTLNQAYQD
NVTVFASVIFQTRKDGSLPPHVHYKIRQNSSFTEKTNEIRRAYWRPGPNTGGRFYFLYGF
VWIQDMMERAIIDTFVGHDVVEPGSYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSV
AMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMH
SHVVIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYMYVAIREEVAH
DKITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTML
MVDAVVYGILTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWARTPRLSV
MEEDQACAMESRRFEETRGMEEEPTHLPLVVCVDKLTKVYKDDKKLALNKLSLNLYENQV
VSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRL
TVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVG
GSRAIILDEPTAGVDPYARRAIWDLILKYKPGRTILLSTHHMDEADLLGDRIAIISHGKL
KCCGSPLFLKGTYGDGYRLTLVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRK
HVASCLLVSDTSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFL
KVSEEDQSLENSEADVKESRKDVLPGAEGPASGEGHAGNLARCSELTQSQASLQSASSVG
SARGDEGAGYTDVYGDYRPLFDNPQDPDNVSLQEVEAEALSRVGQGSRKLDGGWLKVRQF
HGLLVKRFHCARRNSKALFSQILLPAFFVCVAMTVALSVPEIGDLPPLVLSPSQYHNYTQ
PRGNFIPYANEERREYRLRLSPDASPQQLVSTFRLPSGVGATCVLKSPANGSLGPTLNLS
SGESRLLAARFFDSMCLESFTQGLPLSNFVPPPPSPAPSDSPASPDEDLQAWNVSLPPTA
GPEMWTSAPSLPRLVREPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVS
EYLLFTSDRFRLHRYGAITFGNVLKSIPASFGTRAPPMVRKIAVRRAAQVFYNNKGYHSM
PTYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFII
VAMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILF
VFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITAT
VATFLLQLFEHDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKM
KSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPVEDDVDVASERQR
VLRGDADNDMVKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKM
LTGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISW
KDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPK
ARRFLWNLILDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDG
YMITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSG
VLGIEDYSVSQTTLDNVFVNFAKKQSDNLEQQETEPPSALQSPLGCLLSLLRPRSAPTEL
RALVADEPEDLDTEDEGLISFEEERAQLSFNTDTLC
NT seq 7311 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctgcaccagctgcagctgctgctctggaagaacgtgacgctcaaacgccgg
agcccgtgggtcctggccttcgagatcttcatccccctggtgctgttctttatcctgctg
gggctgcgacagaagaagcccaccatctccgtgaaggaagtctccttctacacagcggcg
cccctgacgtctgccggcatcctgcctgtcatgcaatcgctgtgcccggacggccagcga
gacgagttcggcttcctgcagtacgccaactccacggtcacgcagctgcttgagcgcctg
gaccgcgtggtggaggaaggcaacctgtttgacccagcgcggcccagcctgggctcagag
ctcgaggccctacgccagcatctggaggccctcagtgcgggcccgggcacctcggggagc
cacctggacagatccacagtgtcttccttctctctggactcggtggccagaaacccgcag
gagctctggcgtttcctgacgcaaaacttgtcgctgcccaatagcacggcccaagcactc
ttggccgcccgtgtggacccgcccgaggtctaccacctgctctttggtccctcatctgcc
ctggattcacagtctggcctccacaagggtcaggagccctggagccgcctagggggcaat
cccctgttccggatggaggagctgctgctggctcctgccctcctggagcagctcacctgc
acgccgggctcgggggagctgggccggatcctcactgtgcctgagagtcagaagggagcc
ctgcagggctaccgggatgctgtctgcagtgggcaggctgctgcgcgtgccaggcgcttc
tctgggctgtctgctgagctccggaaccagctggacgtggccaaggtctcccagcagctg
ggcctggatgcccccaacggctcggactcctcgccacaggcgccacccccacggaggctg
caggcgcttctgggggacctgctggatgcccagaaggttctgcaggatgtggatgtcctg
tcggccctggccctgctactgccccagggtgcctgcactggccggacccccggaccccca
gccagtggtgcgggtggggcggccaatggcactggggcaggggcagtcatgggccccaac
gccaccgctgaggagggcgcaccctctgctgcagcactggccaccccggacacgctgcag
ggccagtgctcagccttcgtacagctctgggccggcctgcagcccatcttgtgtggcaac
aaccgcaccattgaacccgaggcgctgcggcggggcaacatgagctccctgggcttcacg
agcaaggagcagcggaacctgggcctcctcgtgcacctcatgaccagcaaccccaaaatc
ctgtacgcgcctgcgggctctgaggtcgaccgcgtcatcctcaaggccaacgagactttt
gcttttgtgggcaacgtgactcactatgcccaggtctggctcaacatctcggcggagatc
cgcagcttcctggagcagggcaggctgcagcaacacctgcgctggctgcagcagtatgta
gcagagctgcggctgcaccccgaggcactgaacctgtcactggatgagctgccgccggcc
ctgagacaggacaacttctcgctgcccagtggcatggccctcctgcagcagctggatacc
attgacaacgcggcctgcggctggatccagttcatgtccaaggtgagcgtggacatcttc
aagggcttccccgacgaggagagcattgtcaactacaccctcaaccaggcctaccaggac
aacgtcactgtttttgccagtgtgatcttccagacccggaaggacggctcgctcccgcct
cacgtgcactacaagatccgccagaactccagcttcaccgagaaaaccaacgagatccgc
cgcgcctactggcggcctgggcccaatactggcggccgcttctacttcctctacggcttc
gtctggatccaggacatgatggagcgcgccatcatcgacacttttgtggggcacgatgtg
gtggagccaggcagctacgtgcagatgttcccctacccctgctacacacgcgatgacttc
ctgtttgtcattgagcacatgatgccgctgtgcatggtgatctcctgggtctactccgtg
gccatgaccatccagcacatcgtggcggagaaggagcaccggctcaaggaggtgatgaag
accatgggcctgaacaacgcggtgcactgggtggcctggttcatcaccggctttgtgcag
ctgtccatctccgtgacagcactcaccgccatcctgaagtacggccaggtgcttatgcac
agccacgtggtcatcatctggctcttcctggcagtctacgcggtggccaccatcatgttc
tgcttcctggtgtctgtgctgtactccaaggccaagctggcctcggcctgcggtggcatc
atctacttcctgagctacgtgccctacatgtacgtggcgatccgagaggaggtggcgcat
gataagatcacggccttcgagaagtgcatcgcgtccctcatgtccacgacggcctttggt
ctgggctctaagtacttcgcgctgtatgaggtggccggcgtgggcatccagtggcacacc
ttcagccagtccccggtggagggggacgacttcaacttgctcctggctgtcaccatgctg
atggtggacgccgtggtctatggcatcctcacgtggtacattgaggctgtgcacccaggc
atgtacgggctgccccggccctggtacttcccactgcagaagtcctactggctgggcagt
gggcggacagaagcctgggagtggagctggccgtgggcacgcaccccccgcctcagtgtc
atggaggaggaccaggcctgtgccatggagagccggcgctttgaggagacccgtggcatg
gaggaggagcccacccacctgcctctggttgtctgcgtggacaaactcaccaaggtctac
aaggacgacaagaagctggccctgaacaagctgagcctgaacctctacgagaaccaggtg
gtctccttcttgggccacaacggggcgggcaagaccaccaccatgtccatcctgaccggc
ctgttccctccaacgtcgggttccgccaccatctacgggcacgacatccgcacggagatg
gatgagatccgcaagaacctgggcatgtgcccgcagcacaatgtgctctttgaccggctc
acggtggaggaacacctctggttctactcacggctcaagagcatggctcaggaggagatc
cgcagagagatggacaagatgatcgaggacctggagctctccaacaaacggcactcactg
gtgcagacattgtcgggtggcatgaagcgcaagctgtccgtggccatcgccttcgtgggc
ggctctcgcgccatcatcctggacgagcccacggcgggcgtggacccctacgcgcgccgc
gccatctgggacctcatcctgaagtacaagccaggccgcaccatccttctgtccacccac
cacatggatgaggctgacctgcttggggaccgcattgccatcatctcccatgggaagctc
aagtgctgcggctccccgctcttcctcaagggcacctatggcgacgggtaccgcctcacg
ctggtcaagcggcccgccgagccggggggcccccaagagccagggctggcatccagcccc
ccaggtcgggccccgctgagcagctgctccgagctccaggtgtcccagttcatccgcaag
catgtggcctcctgcctgctggtctcagacacaagcacggagctctcctacatcctgccc
agcgaggccgccaagaagggggctttcgagcgcctcttccagcacctggagcgcagcctg
gatgcactgcacctcagcagcttcgggctgatggacacgaccctggaggaagtgttcctc
aaggtgtcggaggaggatcagtcgctggagaacagtgaggccgatgtgaaggagtccagg
aaggatgtgctccctggggcggagggcccggcgtctggggagggtcacgctggcaatctg
gcccggtgctcggagctgacccagtcgcaggcatcgctgcagtcggcgtcatctgtgggc
tctgcccgtggcgacgagggagctggctacaccgacgtctatggcgactaccgccccctc
tttgataacccacaggacccagacaatgtcagcctgcaagaggtggaggcagaggccctg
tcgagggtcggccagggcagccgcaagctggacggcgggtggctgaaggtgcgccagttc
cacgggctgctggtcaaacgcttccactgcgcccgccgcaactccaaggcactcttctcc
cagatcttgctgccagccttcttcgtctgcgtggccatgaccgtggccctgtccgtcccg
gagattggtgatctgcccccgctggtcctgtcaccttcccagtaccacaactacacccag
ccccgtggcaatttcatcccctacgccaacgaggagcgccgcgagtaccggctgcggcta
tcgcccgacgccagcccccagcagctcgtgagcacgttccggctgccgtcgggggtgggt
gccacctgcgtgctcaagtctcccgccaacggctcgctggggcccacgttgaacctgagc
agcggggagtcgcgcctgctggcggctcggttcttcgacagcatgtgtctggagtccttc
acacaggggctgccactgtccaatttcgtgccacccccaccctcgcccgccccatctgac
tcgccagcgtccccggatgaggacctgcaggcctggaacgtctccctgccgcccaccgct
gggccagaaatgtggacgtcggcaccctccctgccgcgcctggtacgggagcccgtccgc
tgcacctgctctgcgcagggcaccggcttctcctgccccagcagtgtgggcgggcacccg
ccccagatgcgggtggtcacaggcgacatcctgaccgacatcaccggccacaatgtctct
gagtacctgctcttcacctccgaccgcttccgactgcaccggtatggggccatcaccttt
ggaaacgtcctgaagtccatcccagcctcatttggcaccagggccccacccatggtgcgg
aagatcgcggtgcgcagggctgcccaggttttctacaacaacaagggctatcacagcatg
cccacctacctcaacagcctcaacaacgccatcctgcgtgccaacctgcccaagagcaag
ggcaacccggcggcttacggcatcaccgtcaccaaccaccccatgaataagaccagcgcc
agcctctccctggattacctgctgcagggcacggatgtcgtcatcgccatcttcatcatc
gtggccatgtccttcgtgccggccagcttcgttgtcttcctcgtggccgagaagtccacc
aaggccaagcacctgcagtttgtcagcggctgcaaccccatcatctactggctggcgaac
tacgtgtgggacatgctcaactacctggtccccgctacctgctgtgtcatcatcctgttt
gtgttcgacctgccggcctacacgtcgcccaccaacttccctgccgtcctctccctcttc
ctgctctatgggtggtccatcacgcccatcatgtacccggcctccttctggttcgaggtc
cccagctccgcctacgtgttcctcattgtcatcaatctcttcatcggcatcaccgccacc
gtggccaccttcctgctacagctcttcgagcacgacaaggacctgaaggttgtcaacagt
tacctgaaaagctgcttcctcattttccccaactacaacctgggccacgggctcatggag
atggcctacaacgagtacatcaacgagtactacgccaagattggccagtttgacaagatg
aagtccccgttcgagtgggacattgtcacccgcggactggtggccatggcggttgagggc
gtcgtgggcttcctcctgaccatcatgtgccagtacaacttcctgcggcggccacagcgc
atgcctgtgtctaccaagcctgtggaggatgatgtggacgtggccagtgagcggcagcga
gtgctccggggagacgccgacaatgacatggtcaagattgagaacctgaccaaggtctac
aagtcccggaagattggccgtatcctggccgttgaccgcctgtgcctgggtgtgcgtcct
ggcgagtgcttcgggctcctgggcgtcaacggtgcgggcaagaccagcaccttcaagatg
ctgaccggcgacgagagcacgacggggggcgaggccttcgtcaatggacacagcgtgctg
aaggagctgctccaggtgcagcagagcctcggctactgcccgcagtgtgacgcgctgttc
gacgagctcacggcccgggagcacctgcagctgtacacgcggctgcgtgggatctcctgg
aaggacgaggcccgggtggtgaagtgggctctggagaagctggagctgaccaagtacgca
gacaagccggctggcacctacagcggcggcaacaagcggaagctctccacggccatcgcc
ctcattgggtacccagccttcatcttcctggacgagcccaccacaggcatggaccccaag
gcccggcgcttcctctggaacctcatccttgacctcatcaagacagggcgttcagtggtg
ctgacatcacacagcatggaggagtgcgaggcgctgtgcacgcggctggccatcatggtg
aacggtcgcctgcggtgcctgggcagcatccagcacctgaagaaccggtttggagatggc
tacatgatcacggtgcggaccaagagcagccagagtgtgaaggacgtggtgcggttcttc
aaccgcaacttcccggaagccatgctcaaggagcggcaccacacaaaggtgcagtaccag
ctcaagtcggagcacatctcgctggcccaggtgttcagcaagatggagcaggtgtctggc
gtgctgggcatcgaggactactcggtcagccagaccacactggacaatgtgttcgtgaac
tttgccaagaagcagagtgacaacctggagcagcaggagacggagccgccatccgcactg
cagtcccctctcggctgcttgctcagcctgctccggccccggtctgcccccacggagctc
cgggcacttgtggcagacgagcccgaggacctggacacggaggacgagggcctcatcagc
ttcgaggaggagcgggcccagctgtccttcaacacggacacgctctgctga

DBGET integrated database retrieval system