KEGG   Homo sapiens (human): 2005Help
Entry
2005              CDS       T01001                                 

Gene name
ELK4, SAP1
Definition
(RefSeq) ELK4, ETS transcription factor
  KO
K04376  
ETS domain-containing protein Elk-4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
HTLV-I infection
Transcriptional misregulation in cancer
Disease
H00024  
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2005 (ELK4)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2005 (ELK4)
  Infectious diseases
   05166 HTLV-I infection
    2005 (ELK4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2005 (ELK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P28324(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 431 aa AA seqDB search
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS
RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDV
ENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKS
PQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPT
SASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQ
TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST
PGPFSPDLQKT
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgctatcaccctgtggcagttccttcttcagctcctgcagaagcctcagaac
aagcacatgatctgttggacctctaatgatgggcagtttaagcttttgcaggcagaagag
gtggctcgtctctgggggattcgcaagaacaagcctaacatgaattatgacaaactcagc
cgagccctcagatactattatgtaaagaatatcatcaaaaaagtgaatggtcagaagttt
gtgtacaagtttgtctcttatccagagattttgaacatggatccaatgacagtgggcagg
attgagggtgactgtgaaagtttaaacttcagtgaagtcagcagcagttccaaagatgtg
gagaatggagggaaagataaaccacctcagcctggtgccaagacctctagccgcaatgac
tacatacactctggcttatattcttcatttactctcaactctttgaactcctccaatgta
aagcttttcaaattgataaagactgagaatccagccgagaaactggcagagaaaaaatct
cctcaggagcccacaccatctgtcatcaaatttgtcacgacaccttccaaaaagccaccg
gttgaacctgttgctgccaccatttcaattggcccaagtatttctccatcttcagaagaa
actatccaagctttggagacattggtttccccaaaactgccttccctggaagccccaacc
tctgcctctaacgtaatgactgcttttgccaccacaccacccatttcgtccataccccct
ttgcaggaacctcccagaacaccttcaccaccactgagttctcacccagacatcgacaca
gacattgattcagtggcttctcagccaatggaacttccagagaatttgtcactggagcct
aaagaccaggattcagtcttgctagaaaaggacaaagtaaataattcatcaagatccaag
aaacccaaagggttagaactggcacccacccttgtgatcacgagcagtgatccaagccca
ctgggaatactgagcccatctctccctacagcttctcttacaccagcatttttttcacag
acacccatcatactgactccaagccccttgctctccagtatccacttctggagtactctc
agtcctgttgctcccctaagtccagccagactgcaaggtgctaacacacttttccagttt
ccttctgtactgaacagtcatgggccattcactctgtctgggctggatggaccttccacc
cctggcccattttccccagacctacagaagacataa

DBGET integrated database retrieval system