KEGG   Homo sapiens (human): 200734Help
Entry
200734            CDS       T01001                                 

Gene name
SPRED2, Spred-2
Definition
sprouty-related, EVH1 domain containing 2
Orthology
K04703  
sprouty-related, EVH1 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    200734 (SPRED2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     200734 (SPRED2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p14
AA seq 415 aa AA seqDB search
MASPGSDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGER
QKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLI
EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHL
HDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKYPDP
SEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRRKED
GERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTD
PCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcctggcagtgacagctatattgtgcgtgtcaaggctgtggttatgaccaga
gatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgcgtcggggtc
tgtaaggtcatgcaccccgaaggcaatggacgaagcggctttctcatccatggtgaacga
cagaaagacaaactggtggtattggaatgctatgtaagaaaggacttggtctacaccaaa
gccaatccaacgtttcatcactggaaggtcgataataggaagtttggacttactttccaa
agccctgctgatgcccgagcctttgacaggggagtaaggaaagcaatcgaagaccttata
gaaggttcaacaacgtcatcttccaccatccataatgaagctgagcttggcgatgatgac
gtttttacaacagctacagacagttcttctaattcctctcagaagagagagcaacctact
cggacaatctcctctcccacatcctgtgagcaccggaggatttataccctgggccacctc
cacgactcataccccacagaccactatcacctcgatcagccgatgccaaggccctaccgc
caggtgagcttcccggacgacgacgaggagatcgtgcgcatcaacccccgggagaagatc
tggatgacggggtacgaggattaccggcacgcacccgtcaggggcaagtacccggacccc
tcggaggacgcggactcctcctacgtgcgcttcgccaagggcgaggtccccaagcatgac
tacaactacccctacgtggactcctcagactttggcctaggcgaggaccccaaaggccgc
gggggcagcgtgatcaagacgcagccctcccggggcaagtcgcggcggcggaaggaggac
ggagagcgctcgcggtgcgtgtactgcagggacatgttcaaccacgaggagaaccgccgg
ggccactgccaggacgcgcccgactccgtgagaacttgcatccgccgggtgagctgcatg
tggtgcgcggacagcatgctctatcactgtatgtcggaccccgagggagactatacagac
ccttgctcgtgcgatactagcgacgagaagttttgcctccggtggatggctcttattgcc
ttgtctttcctggccccctgtatgtgctgttacctgccccttcgggcctgctaccactgc
ggagtgatgtgcaggtgctgtggcgggaagcacaaagcggccgcgtga

DBGET integrated database retrieval system