KEGG   Homo sapiens (human): 200734Help
Entry
200734            CDS       T01001                                 

Gene name
SPRED2, Spred-2
Definition
(RefSeq) sprouty related EVH1 domain containing 2
  KO
K04703  
sprouty-related, EVH1 domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     200734 (SPRED2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p14
AA seq 418 aa AA seqDB search
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaaacacacccagacgatgacagctatattgtgcgtgtcaaggctgtggtt
atgaccagagatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgc
gtcggggtctgtaaggtcatgcaccccgaaggcaatggacgaagcggctttctcatccat
ggtgaacgacagaaagacaaactggtggtattggaatgctatgtaagaaaggacttggtc
tacaccaaagccaatccaacgtttcatcactggaaggtcgataataggaagtttggactt
actttccaaagccctgctgatgcccgagcctttgacaggggagtaaggaaagcaatcgaa
gaccttatagaaggttcaacaacgtcatcttccaccatccataatgaagctgagcttggc
gatgatgacgtttttacaacagctacagacagttcttctaattcctctcagaagagagag
caacctactcggacaatctcctctcccacatcctgtgagcaccggaggatttataccctg
ggccacctccacgactcataccccacagaccactatcacctcgatcagccgatgccaagg
ccctaccgccaggtgagcttcccggacgacgacgaggagatcgtgcgcatcaacccccgg
gagaagatctggatgacggggtacgaggattaccggcacgcacccgtcaggggcaagtac
ccggacccctcggaggacgcggactcctcctacgtgcgcttcgccaagggcgaggtcccc
aagcatgactacaactacccctacgtggactcctcagactttggcctaggcgaggacccc
aaaggccgcgggggcagcgtgatcaagacgcagccctcccggggcaagtcgcggcggcgg
aaggaggacggagagcgctcgcggtgcgtgtactgcagggacatgttcaaccacgaggag
aaccgccggggccactgccaggacgcgcccgactccgtgagaacttgcatccgccgggtg
agctgcatgtggtgcgcggacagcatgctctatcactgtatgtcggaccccgagggagac
tatacagacccttgctcgtgcgatactagcgacgagaagttttgcctccggtggatggct
cttattgccttgtctttcctggccccctgtatgtgctgttacctgccccttcgggcctgc
taccactgcggagtgatgtgcaggtgctgtggcgggaagcacaaagcggccgcgtga

DBGET integrated database retrieval system