KEGG   Homo sapiens (human): 200879Help
Entry
200879            CDS       T01001                                 

Gene name
LIPH, AH, ARWH2, LAH2, LPDLR, PLA1B, mPA-PLA1
Definition
lipase, member H (EC:2.7.11.30)
Organism
hsa  Homo sapiens (human)
Disease
H00667  
Woolly hair
H00784  
Localized autosomal recessive hypotrichosis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27
AA seq 451 aa AA seqDB search
MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSS
AFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHA
SSKTRKVAMVLKEFIDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPA
GPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGG
FQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYAD
NWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIKLRDKAGNTTE
SKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAH
PERPQLCRYDLVLMENVETVFQPILCPELQL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttgagattctacttattcatcagtttgttgtgcttgtcaagatcagacgcagaagaa
acatgtccttcattcaccaggctgagctttcacagtgcagtggttggtacgggactaaat
gtgaggctgatgctctacacaaggaaaaacctgacctgcgcacaaaccatcaactcctca
gcttttgggaacttgaatgtgaccaagaaaaccaccttcattgtccatggattcaggcca
acaggctcccctcctgtttggatggatgacttagtaaagggtttgctctctgttgaagac
atgaacgtagttgttgttgattggaatcgaggagctacaactttaatatatacccatgcc
tctagtaagaccagaaaagtagccatggtcttgaaggaatttattgaccagatgttggca
gaaggagcttctcttgatgacatttacatgatcggagtaagtctaggagcccacatatct
gggtttgttggagagatgtacgatggatggctggggagaattacaggcctcgaccctgca
ggccctttattcaacgggaaacctcaccaagacagattagatcccagtgatgcgcagttt
gttgatgtcatccattccgacactgatgcactgggctacaaggagccattaggaaacata
gacttctacccaaatggaggattggatcaacctggctgccccaaaacaatattgggagga
tttcagtattttaaatgtgaccaccagaggtctgtatacctgtacctgtcttccctgaga
gagagctgcaccatcactgcgtatccctgtgactcctaccaggattataggaatggcaag
tgtgtcagctgcggcacgtcacaaaaagagtcctgtccccttctgggctattatgctgat
aattggaaagaccatctaagggggaaagatcctccaatgacgaaggcattctttgacaca
gctgaggagagcccattctgcatgtatcattactttgtggatattataacatggaacaag
aatgtaagaagaggggacattaccatcaaattgagagacaaagctggaaacaccacagaa
tccaaaatcaatcatgaacccaccacatttcagaaatatcaccaagtgagtctacttgca
agatttaatcaagatctggataaagtggctgcaatttccttgatgttctctacaggatct
ctaataggcccaaggtacaagctcaggattctccgaatgaagttaaggtcccttgcccat
ccggagaggcctcagctgtgtcggtatgatcttgtcctgatggaaaacgttgaaacagtc
ttccaacctattctttgcccagagttgcagttgtaa

DBGET integrated database retrieval system