KEGG   Homo sapiens (human): 200895Help
Entry
200895            CDS       T01001                                 

Gene name
DHFR2, DHFRL1, DHFRP4
Definition
(RefSeq) dihydrofolate reductase 2
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Antifolate resistance
Drug target
Edatrexate: 
Methotrexate (DG00681): 
Pralatrexate: 
Trimetrexate (DG01013): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    200895 (DHFR2)
   00670 One carbon pool by folate
    200895 (DHFR2)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    200895 (DHFR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     200895 (DHFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q86XF0(Tbio)
UniProt: 
Position
3q11.2
AA seq 187 aa AA seqDB search
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKF
EVCEKDD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttgctaaactgcatcgtcgctgtgtcccaaaacatgggcatcggcaagaac
ggggacctgcccaggccgccgctcaggaatgaattcaggtatttccagagaatgaccaca
acttcttcagtagagggtaaacagaatctggtgattatgggtaggaagacctggttctcc
attcctgagaagaatcgacctttaaaggatagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcattttcttgccagaagtttggatgatgccttaaaactt
actgaacgaccagaattagcaaataaagtagacatgatttggatagttggtggcagttct
gtttataaggaagccatgaatcacctaggccatcttaaactatttgtgacaaggatcatg
caggactttgaaagtgacacgtttttttcagaaattgacttggagaaatataaacttctg
cctgaatacccaggtgttctctctgatgtccaggaggggaaacacatcaagtacaaattt
gaagtatgtgagaaggatgattaa

DBGET integrated database retrieval system