KEGG   Homo sapiens (human): 200895Help
Entry
200895            CDS       T01001                                 

Gene name
DHFRL1, DHFRP4
Definition
dihydrofolate reductase-like 1 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Drug target
Methotrexate: 
Pralatrexate: 
Trimetrexate: 
Other: 
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hsa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hsa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q11.1
AA seq 187 aa AA seqDB search
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
VYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKF
EVCEKDD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttgctaaactgcatcgtcgctgtgtcccaaaacatgggcatcggcaagaac
ggggacctgcccaggccgccgctcaggaatgaattcaggtatttccagagaatgaccaca
acttcttcagtagagggtaaacagaatctggtgattatgggtaggaagacctggttctcc
attcctgagaagaatcgacctttaaaggatagaattaatttagttctcagcagagaactc
aaggaacctccacaaggagctcattttcttgccagaagtttggatgatgccttaaaactt
actgaacgaccagaattagcaaataaagtagacatgatttggatagttggtggcagttct
gtttataaggaagccatgaatcacctaggccatcttaaactatttgtgacaaggatcatg
caggactttgaaagtgacacgtttttttcagaaattgacttggagaaatataaacttctg
cctgaatacccaggtgttctctctgatgtccaggaggggaaacacatcaagtacaaattt
gaagtatgtgagaaggatgattaa

DBGET integrated database retrieval system