KEGG   Homo sapiens (human): 200931Help
Entry
200931            CDS       T01001                                 

Gene name
SLC51A, OSTA, OSTalpha
Definition
solute carrier family 51, alpha subunit
Orthology
K14360  
organic solute transporter subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    200931 (SLC51A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 340 aa AA seqDB search
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLL
ALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTIT
SFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLL
MLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIIS
RQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCH
LLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggcaggacccagataaagcttgaccccaggtacacagcagatcttctggag
gtgctgaagaccaattacggcatcccctccgcctgcttctctcagcctcccacagcagcc
caactcctgagagccctgggccctgtggaacttgccctcactagcatcctgaccttgctg
gcgctgggctccattgccatcttcctggaggatgccgtctacctgtacaagaacaccctt
tgccccatcaagaggcggactctgctctggaagagctcggcacccacggtggtgtctgtg
ctgtgctgctttggtctctggatccctcgttccctggtgctggtggaaatgaccatcacc
tcgttttatgccgtgtgcttttacctgctgatgctggtcatggtggaaggctttgggggg
aaggaggcagtgctgaggacgctgagggacaccccgatgatggtccacacaggcccctgc
tgctgctgctgcccctgctgtccacggctgctgctcaccaggaagaagcttcagctgctg
atgttgggccctttccaatacgccttcttgaagataacgctgaccctggtgggcctgttt
ctcgtccccgacggcatctatgacccagcagacatttctgaggggagcacagctctatgg
atcaacactttccttggcgtgtccacactgctggctctctggaccctgggcatcatttcc
cgtcaagccaggctacacctgggtgagcagaacatgggagccaaatttgctctgttccag
gttctcctcatcctgactgccctacagccctccatcttctcagtcttggccaacggtggg
cagattgcttgttcgcctccctattcctctaaaaccaggtctcaagtgatgaattgccac
ctcctcatactggagacttttctaatgactgtgctgacacgaatgtactaccgaaggaaa
gaccacaaggttgggtatgaaactttctcttctccagacctggacttgaacctcaaagcc
taa

DBGET integrated database retrieval system