KEGG   Homo sapiens (human): 200959Help
Entry
200959            CDS       T01001                                 

Gene name
GABRR3
Definition
gamma-aminobutyric acid (GABA) A receptor, rho 3
Orthology
K05190  
gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    200959 (GABRR3)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    200959 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    200959 (GABRR3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    200959 (GABRR3)
   05033 Nicotine addiction
    200959 (GABRR3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   200959 (GABRR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q11.2
AA seq 467 aa AA seqDB search
MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQK
YEQLLHIEDNDFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
FPSTANKSMTFDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFS
ASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARV
SLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEER
KQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggctttccagttagtctccttcacctacatctggatcatattgaaaccaaat
gtttgtgctgcttctaacatcaagatgacacaccagcggtgctcctcttcaatgaaacaa
acctgcaaacaagaaactagaatgaagaaagatgacagtaccaaagcgcggcctcagaaa
tatgagcaacttctccatatagaggacaacgatttcgcaatgagacctggatttggaggg
tctccagtgccagtaggtatagatgtccatgttgaaagcattgacagcatttcagagact
aacatggactttacaatgactttttatctcaggcattactggaaagacgagaggctctcc
tttcctagcacagcaaacaaaagcatgacatttgatcatagattgaccagaaagatctgg
gtgcctgatatcttttttgtccactctaaaagatccttcatccatgatacaactatggag
aatatcatgctgcgcgtacaccctgatggaaacgtcctcctaagtctcaggataacggtt
tcggccatgtgctttatggatttcagcaggtttcctcttgacactcaaaattgttctctt
gaactggaaagctatgcctacaatgaggatgacctaatgctatactggaaacacggaaac
aagtccttaaatactgaagaacatatgtccctttctcagttcttcattgaagacttcagt
gcatctagtggattagctttctatagcagcacaggttggtacaataggcttttcatcaac
tttgtgctaaggaggcatgttttcttctttgtgctgcaaacctatttcccagccatattg
atggtgatgctttcatgggtttcattttggattgaccgaagagctgttcctgcaagagtt
tccctgggaatcaccacagtgctgaccatgtccacaatcatcactgctgtgagcgcctcc
atgccccaggtgtcctacctcaaggctgtggatgtgtacctgtgggtcagctccctcttt
gtgttcctgtcagtcattgagtatgcagctgtgaactacctcaccacagtggaagagcgg
aaacaattcaagaagacaggaaagatttctaggatgtacaatattgatgcagttcaagct
atggcctttgatggttgttaccatgacagcgagattgacatggaccagacttccctctct
ctaaactcagaagacttcatgagaagaaaatcgatatgcagccccagcaccgattcatct
cggataaagagaagaaaatccctaggaggacatgttggtagaatcattctggaaaacaac
catgtcattgacacctattctaggattttattccccattgtgtatattttatttaatttg
ttttactggggtgtatatgtatga

DBGET integrated database retrieval system