KEGG   Homo sapiens (human): 2011Help
Entry
2011              CDS       T01001                                 

Gene name
MARK2, EMK-1, EMK1, PAR-1, Par-1b, Par1b
Definition
(RefSeq) microtubule affinity regulating kinase 2 (EC:2.7.11.1 2.7.11.26)
  KO
K08798  
MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2011 (MARK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   2011 (MARK2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     2011 (MARK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 788 aa AA seqDB search
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgctcggacccccctacccacgctgaacgagagggacacggagcagcccacc
ttgggacaccttgactccaagcccagcagtaagtccaacatgattcggggccgcaactca
gccacctctgctgatgagcagccccacattggaaactaccggctcctcaagaccattggc
aagggtaattttgccaaggtgaagttggcccgacacatcctgactgggaaagaggtagct
gtgaagatcattgacaagactcaactgaactcctccagcctccagaaactattccgcgaa
gtaagaataatgaaggttttgaatcatcccaacatagttaaattatttgaagtgattgag
actgagaaaacgctctaccttgtcatggagtacgctagtggcggagaggtatttgattac
ctagtggctcatggcaggatgaaagaaaaagaggctcgagccaaattccgccagatagtg
tctgctgtgcagtactgtcaccagaagtttattgtccatagagacttaaaggcagaaaac
ctgctcttggatgctgatatgaacatcaagattgcagactttggcttcagcaatgaattc
acctttgggaacaagctggacaccttctgtggcagtcccccttatgctgccccagaactc
ttccagggcaaaaaatatgatggacccgaggtggatgtgtggagcctaggagttatcctc
tatacactggtcagcggatccctgccttttgatggacagaacctcaaggagctgcgggaa
cgggtactgaggggaaaataccgtattccattctacatgtccacggactgtgaaaacctg
cttaagaaatttctcattcttaatcccagcaagagaggcactttagagcaaatcatgaaa
gatcgatggatgaatgtgggtcacgaagatgatgaactaaagccttacgtggagccactc
cctgactacaaggacccccggcggacagagctgatggtgtccatgggttatacacgggaa
gagatccaggactcgctggtgggccagagatacaacgaggtgatggccacctatctgctc
ctgggctacaagagctccgagctggaaggcgacaccatcaccctgaaaccccggccttca
gctgatctgaccaatagcagcgccccatccccatcccacaaggtacagcgcagcgtgtcg
gccaatcccaagcagcggcgcttcagcgaccaggcagctggtcctgccattcccacctct
aattcttactctaagaagactcagagtaacaacgcagaaaataagcggcctgaggaggac
cgggagtcagggcggaaagccagcagcacagccaaggtgcctgccagccccctgcccggt
ctggagaggaagaagaccaccccaaccccctccacgaacagcgtcctctccaccagcaca
aatcgaagcaggaattccccacttttggagcgggccagcctcggccaggcctccatccag
aatggcaaagacagcctaaccatgccagggtcccgggcctccacggcttctgcttctgcc
gcagtctctgcggcccggccccgccagcaccagaaatccatgtcggcctccgtgcacccc
aacaaggcctctgggctgccccccacggagagtaactgtgaggtgccgcggcccagcaca
gccccccagcgtgtccctgttgcctccccatccgcccacaacatcagcagcagtggtgga
gccccagaccgaactaacttcccccggggtgtgtccagccgaagcaccttccatgctggg
cagctccgacaggtgcgggaccagcagaatttgccctacggtgtgaccccagcctctccc
tctggccacagccagggccggcggggggcctctgggagcatcttcagcaagttcacctcc
aagtttgtacgcagaaatctgtctttcaggtttgccagaaggaacctgaatgaacctgaa
agcaaagaccgagtggagacgctcagacctcacgtggtgggcagtggcggcaacgacaaa
gaaaaggaagaatttcgggaggccaagccccgctccctccgcttcacgtggagtatgaag
accacgagctccatggagcccaacgagatgatgcgggagatccgcaaggtgctggacgcg
aacagctgccagagcgagctgcatgagaagtacatgctgctgtgcatgcacggcacgccg
ggccacgaggacttcgtgcagtgggagatggaggtgtgcaaactgccgcggctctctctc
aacggggttcgatttaagcggatatcgggcacctccatggccttcaaaaacattgcctcc
aaaatagccaacgagctgaagctttaa

DBGET integrated database retrieval system