KEGG   Homo sapiens (human): 2021Help
Entry
2021              CDS       T01001                                 

Gene name
ENDOG
Definition
(RefSeq) endonuclease G
  KO
K01173  
endonuclease G, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    2021 (ENDOG)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    2021 (ENDOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14249(Tbio)
UniProt: 
Position
9q34.11
AA seq 297 aa AA seqDB search
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRG
PGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDS
VHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLE
KYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGG
QIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgctgcgggccggcctgaccctggcgtcgggcgcggggctgggtgcggtcgtc
gagggctggcggcggcggcgggaggacgcgcgggcggcgccgggactgctgggccggctg
cccgtgctgcccgtggcggcggcagccgagttgccccctgtgcccgggggaccccgcggc
ccgggcgagctggccaagtacgggctgccggggctggcgcagctcaagagccgcgagtcg
tacgtgctgtgctacgacccgcgcacccgcggcgcgctctgggtggtggagcagctgcga
cccgagcgtctccgcggcgacggcgaccggcgcgagtgcgacttccgcgaggacgactcg
gtgcacgcgtaccaccgtgccaccaacgccgactaccgcggcagtggcttcgaccgcggt
cacctggccgccgccgccaaccaccgctggagccagaaggccatggacgacacgttctac
ctgagcaacgtcgcgccccaggtgccccacctcaaccagaatgcctggaacaacctggag
aaatatagccgcagcttgacccgcagctaccaaaacgtctatgtctgcacagggccactc
ttcctgcccaggacagaggctgatgggaaatcctacgtaaagtaccaggtcatcggcaag
aaccacgtggcagtgcccacacacttcttcaaggtgctgatcctggaggcagcaggtggg
caaattgagctccgcacctacgtgatgcccaacgcacctgtggatgaggccatcccactg
gagcgcttcctggtgcccatcgagagcattgagcgggcttcggggctgctctttgtgcca
aacatcctggcgcgggcaggcagcctcaaggccatcacggcgggcagtaagtga

KEGG   Homo sapiens (human): 23052Help
Entry
23052             CDS       T01001                                 

Gene name
ENDOD1
Definition
(RefSeq) endonuclease domain containing 1
  KO
K15049  
endonuclease domain-containing 1 protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O94919(Tdark)
UniProt: 
Position
11q21
AA seq 500 aa AA seqDB search
MGTARWLALGSLFALAGLLEGRLVGEEEAGFGECDKFFYAGTPPAGLAADSHVKICQRAE
GAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITS
VNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHS
LMDRALTPQCGSGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHT
RDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQK
SSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLVVAILKNIVYF
LWCVTKQVINGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLL
KAICRVLSIPVRVLVDVATFPVYTMGAIPIVCKDIALGLGGTVSLLFDTAFGTLGGLFQV
VFSVCKRIGYKVTFDNSGEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgcgcgctggctcgcgctgggcagcctcttcgccctggctgggctgctggaa
ggccggctcgtgggcgaggaggaagccggctttggcgaatgtgacaagttcttctacgcc
gggaccccgcctgcggggctggcggccgattcccacgtgaagatctgtcagcgcgcggag
ggtgctgagcgcttcgccaccctctacagcacccgggaccgcatccccgtgtactccgcg
ttccgcgccccgcgccctgcgcccggcggcgccgagcagcgatggctggtggagccgcag
atcgatgaccccaacagcaaccttgaggaggcgattaatgaggcagaggccatcacctct
gtgaacagcctgggaagcaagcaagccttgaatacagattaccttgattctgattaccaa
agaggacagctttacccattctcccttagcagtgatgtccaggtggccacatttactctc
acaaattcagccccaatgactcagtccttccaggaacggtggtatgtgaatctccacagc
ctaatggaccgggctttgaccccacagtgtggcagtggggaagacctatatatcctcaca
ggcacagtgccctcagactacagagttaaagacaaagtggcagtccctgagtttgtttgg
ctggcagcctgttgtgctgtccctggaggaggctgggccatgggctttgtcaagcacacc
cgggacagtgacatcatagaagatgtgatggtaaaagatcttcagaaactgcttccattt
aaccctcagctgtttcagaacaactgtggtgaaactgagcaagacacagagaaaatgaaa
aaaatcctggaagtggttaaccaaatccaggatgaagaacgaatggtacaatctcaaaag
agttctagtcccctttctagcaccaggagcaagaggtctactctgttgcctccagaggca
tctgagggaagtagtagctttttgggaaaactcatgggcttcattgctaccccattcatc
aagctttttcaattaatttattaccttgtggtagcaatcctgaagaacattgtctatttc
ctgtggtgtgttaccaagcaggtgattaatggcatagaaagttgcctttaccgcctgggc
tcagccaccatctcatacttcatggccattggggaagagttggtgagcattccctggaag
gtgctcaaggtcgtggccaaagtcatcagggctctcctccggatcctttgttgtctgctg
aaggccatttgccgagttctgagcatccctgtccgtgtccttgtggatgtggccactttc
cctgtgtacaccatgggcgctattccaattgtttgcaaggacattgcactgggccttggt
ggcactgtctcactgctctttgacactgcttttggtaccctgggtggcctatttcaggtg
gtttttagtgtctgcaagcggattggctacaaggttacttttgacaattctggggagtta
taa

KEGG   Homo sapiens (human): 9941Help
Entry
9941              CDS       T01001                                 

Gene name
EXOG, ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b, ENGLA, ENGLB
Definition
(RefSeq) exo/endonuclease G
  KO
K15050  
nuclease EXOG, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    9941 (EXOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y2C4(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p22.2
AA seq 368 aa AA seqDB search
MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKA
VLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNI
PPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEM
YCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVS
TEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCK
LLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQS
GTQIRKPS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagagtatcgcttcccgcctccggggttcccgtcgttttctgagcggcttc
gtggctggggctgtagtgggcgctgcgggagctgggctcgcggccctgcagttcttccgg
agtcagggcgctgagggagcgttgacagggaagcagccggatggatctgcagaaaaggct
gtcttggaacaatttggattccctttaactggaacagaggcaaggtgttacactaatcac
gctttgtcttatgatcaggcaaagcgggtgcctagatgggttcttgaacatatttccaaa
agcaagataatgggtgatgcagacagaaagcattgtaaatttaagcctgatcccaatatc
cctccaaccttcagtgccttcaatgaagattatgttggaagtgggtggtcacgaggacac
atggctccagcaggaaataacaaattttcaagtaaagccatggctgaaaccttttacctt
tctaacattgtgcctcaggattttgataataattctggatattggaacagaatagaaatg
tactgtcgagagctgacagaaaggtttgaagatgtttgggtggtatctgggcctttgacc
ttacctcagactagaggcgatggaaagaaaatagttagttaccaggtgattggcgaggac
aacgtggcagtcccctcacacctttataaggtaatcctggcccgcagaagctcagtatct
accgaaccactggcgctaggggcctttgtggtacccaatgaagccatcggcttccagccc
cagttaactgaattccaagtgagcctccaggacctagagaagttgtcaggactggtgttt
tttcctcatttggatagaactagtgatatccggaatatctgctctgtggacacctgtaag
ctcctggatttccaggagttcaccttgtacttgagtacaagaaagattgaaggagcccga
tcagtgctcagactggaaaagatcatggaaaacttgaagaatgcagagattgaaccagat
gattactttatgagtcgctatgagaagaagctagaagaactcaaagctaaggagcagtca
ggaacccagataagaaagccatcctag

DBGET integrated database retrieval system