KEGG   Homo sapiens (human): 2022Help
Entry
2022              CDS       T01001                                 

Gene name
ENG, END, HHT1, ORW1, ORW
Definition
(RefSeq) endoglin
  KO
K06526  
endoglin
Organism
hsa  Homo sapiens (human)
Disease
H00533  
Hereditary hemorrhagic telangiectasia (HHT)
Brite
Cellular antigens [BR:hsa04090]
 Proteins
  2022 (ENG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 658 aa AA seqDB search
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNA
ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAY
NSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLS
FCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVEL
SCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLL
GEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQ
TKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM
ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVS
PSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVP
IPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAF
LIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcggcacgctccctctggctgttgccctgctgctggccagctgcagcctcagc
cccacaagtcttgcagaaacagtccattgtgaccttcagcctgtgggccccgagaggggc
gaggtgacatataccactagccaggtctcgaagggctgcgtggctcaggcccccaatgcc
atccttgaagtccatgtcctcttcctggagttcccaacgggcccgtcacagctggagctg
actctccaggcatccaagcaaaatggcacctggccccgagaggtgcttctggtcctcagt
gtaaacagcagtgtcttcctgcatctccaggccctgggaatcccactgcacttggcctac
aattccagcctggtcaccttccaagagcccccgggggtcaacaccacagagctgccatcc
ttccccaagacccagatccttgagtgggcagctgagaggggccccatcacctctgctgct
gagctgaatgacccccagagcatcctcctccgactgggccaagcccaggggtcactgtcc
ttctgcatgctggaagccagccaggacatgggccgcacgctcgagtggcggccgcgtact
ccagccttggtccggggctgccacttggaaggcgtggccggccacaaggaggcgcacatc
ctgagggtcctgccgggccactcggccgggccccggacggtgacggtgaaggtggaactg
agctgcgcacccggggatctcgatgccgtcctcatcctgcagggtcccccctacgtgtcc
tggctcatcgacgccaaccacaacatgcagatctggaccactggagaatactccttcaag
atctttccagagaaaaacattcgtggcttcaagctcccagacacacctcaaggcctcctg
ggggaggcccggatgctcaatgccagcattgtggcatccttcgtggagctaccgctggcc
agcattgtctcacttcatgcctccagctgcggtggtaggctgcagacctcacccgcaccg
atccagaccactcctcccaaggacacttgtagcccggagctgctcatgtccttgatccag
acaaagtgtgccgacgacgccatgaccctggtactaaagaaagagcttgttgcgcatttg
aagtgcaccatcacgggcctgaccttctgggaccccagctgtgaggcagaggacaggggt
gacaagtttgtcttgcgcagtgcttactccagctgtggcatgcaggtgtcagcaagtatg
atcagcaatgaggcggtggtcaatatcctgtcgagctcatcaccacagcggaaaaaggtg
cactgcctcaacatggacagcctctctttccagctgggcctctacctcagcccacacttc
ctccaggcctccaacaccatcgagccggggcagcagagctttgtgcaggtcagagtgtcc
ccatccgtctccgagttcctgctccagttagacagctgccacctggacttggggcctgag
ggaggcaccgtggaactcatccagggccgggcggccaagggcaactgtgtgagcctgctg
tccccaagccccgagggtgacccgcgcttcagcttcctcctccacttctacacagtaccc
atacccaaaaccggcaccctcagctgcacggtagccctgcgtcccaagaccgggtctcaa
gaccaggaagtccataggactgtcttcatgcgcttgaacatcatcagccctgacctgtct
ggttgcacaagcaaaggcctcgtcctgcccgccgtgctgggcatcacctttggtgccttc
ctcatcggggccctgctcactgctgcactctggtacatctactcgcacacgcgttccccc
agcaagcgggagcccgtggtggcggtggctgccccggcctcctcggagagcagcagcacc
aaccacagcatcgggagcacccagagcaccccctgctccaccagcagcatggcatag

DBGET integrated database retrieval system