KEGG   Homo sapiens (human): 202374Help
Entry
202374            CDS       T01001                                 

Gene name
STK32A, YANK1
Definition
serine/threonine kinase 32A (EC:2.7.11.1)
Orthology
K08793  
serine/threonine kinase 32 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     202374 (STK32A)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  YANK family
   202374 (STK32A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 396 aa AA seqDB search
MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCV
ERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKE
ETVKLFICELVMALDYLQNQRIIHRDMKPDNILLDEHGHVHITDFNIAAMLPRETQITTM
AGTKPYMAPEMFSSRKGAGYSFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVHTFET
TVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
NKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMRKCDSSQTCLLQEHLDSVQKEFI
IFNREKVNRDFNKRQPNLALEQTKDPQGEDGQNNNL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgaacacttcaagaaaaccaccagtgtttgatgaaaatgaagatgtcaacttt
gaccactttgaaattttgcgagccattgggaaaggcagttttgggaaggtctgcattgta
cagaagaatgataccaagaagatgtacgcaatgaagtacatgaataaacaaaagtgcgtg
gagcgcaatgaagtgagaaatgtcttcaaggaactccagatcatgcagggtctggagcac
cctttcctggttaatttgtggtattccttccaagatgaggaagacatgttcatggtggtg
gacctcctgctgggtggagacctgcgttatcacctgcaacagaacgtccacttcaaggaa
gaaacagtgaagctcttcatctgtgagctggtcatggccctggactacctgcagaaccag
cgcatcattcacagggatatgaagcctgacaatattttacttgacgaacatgggcacgtg
cacatcacagatttcaacattgctgcgatgctgcccagggagacacagattaccaccatg
gctggcaccaagccttacatggcacctgagatgttcagctccagaaaaggagcaggctat
tcctttgctgttgactggtggtccctgggagtgacggcatatgaactgctgagaggccgg
agaccgtatcatattcgctccagtacttccagcaaggaaattgtacacacgtttgagacg
actgttgtaacttacccttctgcctggtcacaggaaatggtgtcacttcttaaaaagcta
ctcgaacctaatccagaccaacgattttctcagttatctgatgtccagaacttcccgtat
atgaatgatataaactgggatgcagtttttcagaagaggctcattccaggtttcattcct
aataaaggcaggctgaattgtgatcctacctttgaacttgaggaaatgattttggagtcc
aaacctctacataagaaaaaaaagcgtctggcaaagaaggagaaggatatgaggaaatgc
gattcttctcagacatgtcttcttcaagagcaccttgactctgtccagaaggagttcata
attttcaacagagaaaaagtaaacagggactttaacaaaagacaaccaaatctagccttg
gaacaaaccaaagacccacaaggtgaggatggtcagaataacaacttgtaa

DBGET integrated database retrieval system