KEGG   Homo sapiens (human): 2028Help
Entry
2028              CDS       T01001                                 

Gene name
ENPEP, APA, CD249, gp160
Definition
glutamyl aminopeptidase (aminopeptidase A) (EC:3.4.11.7)
Orthology
K11141  
glutamyl aminopeptidase [EC:3.4.11.7]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    2028 (ENPEP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     2028 (ENPEP)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   2028 (ENPEP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2028 (ENPEP)
Cellular antigens [BR:hsa04090]
 Proteins
  2028 (ENPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q25
AA seq 957 aa AA seqDB search
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcggagagagagggctctaagagatactgcattcaaacgaaacatgtggcc
attctctgtgcggtggtggtgggtgtaggattaatagtgggacttgccgtgggcttgacc
agatcgtgtgactccagcggggacggcgggccgggcactgcgccagctccttcccacctg
ccttcttccacggccagcccctcaggtcctcctgcccaggaccaggacatctgcccggcc
agtgaggatgagagcggacagtggaaaaactttcgactgccggacttcgtcaacccagtc
cactacgacctgcacgtgaagcccctgttggaggaggacacctacacgggcaccgtgagc
atctccatcaacctgagcgctcccacccggtacctgtggctgcacctccgggagaccagg
atcacccggctcccggagctgaagaggccctctggggaccaggtgcaagtccggaggtgt
ttcgagtacaaaaagcaggagtacgtggtggtcgaggcggaggaagagcttacccccagc
agtggagatggcctgtatctcctgaccatggagttcgccggctggctgaacggctccctc
gtgggattttatagaaccacctacacggagaacggacaagtcaagagcatagtggccacc
gatcatgaaccaacagatgccaggaaatcttttccttgttttgatgagcccaacaaaaag
gcaacttatacaatatctatcacccatcccaaagaatacggagcactttcaaatatgcca
gtggcgaaagaagagtcagtggatgataaatggactcgaacaacttttgagaagtctgtc
cccatgagcacgtacctggtgtgctttgctgtacatcaatttgactctgtaaagagaata
tcaaatagtggaaaacctcttacaatttatgtccagccagagcaaaagcacacagccgaa
tatgctgcaaacataactaaaagtgtgtttgattattttgaagaatactttgctatgaat
tattctcttcctaaattagataaaatcgctattccagattttggcactggtgccatggag
aactggggactcatcacgtacagagaaacgaacctgctttatgaccctaaggaatcagcc
tcatcaaaccaacagagggtggccactgtggttgcccatgaacttgtgcatcagtggttt
ggaaatattgtgaccatggactggtgggaagacttgtggctaaatgaaggatttgcttct
ttctttgagtttctgggagtaaaccatgcagaaacagactggcaaatgcgtgaccaaatg
ttacttgaagatgtattacctgttcaagaggatgattctttgatgtcttcgcatccaatt
attgtgactgtgacaacccctgatgaaataacatctgtttttgatggaatatcctatagc
aagggatcttctattttgagaatgcttgaagactggataaaaccagagaattttcaaaaa
ggatgtcagatgtacttggaaaaataccaattcaagaatgcaaaaacttctgatttttgg
gcagcactggaagaggcaagtaggctaccagtgaaagaagtaatggacacctggaccaga
cagatgggttatcctgtgcttaacgtgaacggtgtcaagaacatcacacagaaacgcttt
ttgttggacccaagagctaacccttctcagcccccttcagatcttggttatacatggaat
atcccagttaaatggactgaagataatataacaagcagtgtgttatttaataggtcagaa
aaagaaggaatcactttgaactcctctaatcctagtggaaatgcttttctcaaaataaac
ccagatcatattgggttttatcgtgtaaattatgaagtagcaacttgggactcgatagct
acagcgctctccttgaaccacaagacattttcttcagcagatcgtgcaagtcttattgat
gatgcttttgccttggcaagagctcaacttctagattataaggtggctttgaacttgacc
aagtatctcaaaagggaagagaattttttaccatggcagagagtaatttcagctgtaacc
tacatcattagcatgtttgaagatgataaagagctatatcctatgattgaggaatacttc
caaggtcaagtgaagcctattgcagattctctgggatggaatgatgctggagaccatgtc
acaaagttactccgttcctccgtgttagggtttgcgtgcaagatgggagacagagaagcc
ttgaacaatgcttcctcgttatttgagcagtggctaaatgggactgtaagccttcccgta
aatctcaggcttctggtgtatcggtatgggatgcagaactctggcaatgagatttcatgg
aactacactcttgagcaataccagaaaacttcattagctcaagaaaaagaaaaactgctg
tatggattagcatcagtgaagaacgttactcttttgtcaaggtatttggatttgctcaag
gacacgaaccttattaaaactcaggatgtgtttacagtcattcgatatatctcatataac
agctatgggaagaacatggcctggaattggatacaactcaactgggactatctagtcaac
agatatacactcaataacagaaaccttggccgaattgtcacaatagcagagccattcaac
actgaactgcaactgtggcagatggagagcttttttgcaaaatatccacaagctggagca
ggagaaaaacctagggaacaagtgctggaaacagtgaaaaacaatatagagtggctaaaa
caacatagaaacaccatcagagaatggttttttaatttacttgagagtggttaa

DBGET integrated database retrieval system