KEGG   Homo sapiens (human): 203Help
Entry
203               CDS       T01001                                 

Gene name
AK1, HTL-S-58j
Definition
adenylate kinase 1 (EC:2.7.4.3 2.7.4.6)
Orthology
K00939  
adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00674  
Anemia due to disorders of nucleotide metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 194 aa AA seqDB search
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
SVFSQVCTHLDALK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagctgaagaaaaccaagatcatctttgtggtgggtgggcctggctcaggg
aagggcacccagtgtgagaagatcgtgcagaagtatggctacacccacctctccaccggg
gacctcctgcggtccgaggtcagctcaggctcggccaggggcaagaagctgtcggaaatc
atggagaaggggcagctggttccactggagacagtgttggacatgctccgggatgccatg
gtggccaaagtcaatacttccaaaggcttcctgattgatggctacccgcgggaggtgcag
caaggagaagagtttgagcgacggattggacagcccacactgctgctgtatgtggacgca
ggccctgagaccatgacccagcggctcttgaaacgtggagagaccagcgggcgtgtggac
gacaatgaggagaccatcaaaaagcggctggagacctattacaaggccacagaacccgtc
atcgccttctatgagaaacgtggcattgtgcgcaaggtcaacgctgagggctccgtggac
agtgtcttctcccaggtctgcacccacctggacgccctaaagtag

DBGET integrated database retrieval system