KEGG   Homo sapiens (human): 2034Help
Entry
2034              CDS       T01001                                 

Gene name
EPAS1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73
Definition
endothelial PAS domain protein 1
Orthology
K09095  
hypoxia-inducible factor 2 alpha
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Renal cell carcinoma
Disease
H00236  
Congenital polycythemia
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21-p16
AA seq 870 aa AA seqDB search
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN
FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCS
TPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDF
QLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPE
HRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTE
FLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQ
DLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHL
PLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaaaaggagtagctcggagaggaggaaggagaagtcccgg
gatgctgcgcggtgccggcggagcaaggagacggaggtgttctatgagctggcccatgag
ctgcctctgccccacagtgtgagctcccatctggacaaggcctccatcatgcgactggca
atcagcttcctgcgaacacacaagctcctctcctcagtttgctctgaaaacgagtccgaa
gccgaagctgaccagcagatggacaacttgtacctgaaagccttggagggtttcattgcc
gtggtgacccaagatggcgacatgatctttctgtcagaaaacatcagcaagttcatggga
cttacacaggtggagctaacaggacatagtatctttgacttcactcatccctgcgaccat
gaggagattcgtgagaacctgagtctcaaaaatggctctggttttgggaaaaaaagcaaa
gacatgtccacagagcgggacttcttcatgaggatgaagtgcacggtcaccaacagaggc
cgtactgtcaacctcaagtcagccacctggaaggtcttgcactgcacgggccaggtgaaa
gtctacaacaactgccctcctcacaatagtctgtgtggctacaaggagcccctgctgtcc
tgcctcatcatcatgtgtgaaccaatccagcacccatcccacatggacatccccctggat
agcaagaccttcctgagccgccacagcatggacatgaagttcacctactgtgatgacaga
atcacagaactgattggttaccaccctgaggagctgcttggccgctcagcctatgaattc
taccatgcgctagactccgagaacatgaccaagagtcaccagaacttgtgcaccaagggt
caggtagtaagtggccagtaccggatgctcgcaaagcatgggggctacgtgtggctggag
acccaggggacggtcatctacaaccctcgcaacctgcagccccagtgcatcatgtgtgtc
aactacgtcctgagtgagattgagaagaatgacgtggtgttctccatggaccagactgaa
tccctgttcaagccccacctgatggccatgaacagcatctttgatagcagtggcaagggg
gctgtgtctgagaagagtaacttcctattcaccaagctaaaggaggagcccgaggagctg
gcccagctggctcccaccccaggagacgccatcatctctctggatttcgggaatcagaac
ttcgaggagtcctcagcctatggcaaggccatcctgcccccgagccagccatgggccacg
gagttgaggagccacagcacccagagcgaggctgggagcctgcctgccttcaccgtgccc
caggcagctgccccgggcagcaccacccccagtgccaccagcagcagcagcagctgctcc
acgcccaatagccctgaagactattacacatctttggataacgacctgaagattgaagtg
attgagaagctcttcgccatggacacagaggccaaggaccaatgcagtacccagacggat
ttcaatgagctggacttggagacactggcaccctatatccccatggacggggaagacttc
cagctaagccccatctgccccgaggagcggctcttggcggagaacccacagtccaccccc
cagcactgcttcagtgccatgacaaacatcttccagccactggcccctgtagccccgcac
agtcccttcctcctggacaagtttcagcagcagctggagagcaagaagacagagcccgag
caccggcccatgtcctccatcttctttgatgccggaagcaaagcatccctgccaccgtgc
tgtggccaggccagcacccctctctcttccatggggggcagatccaatacccagtggccc
ccagatccaccattacattttgggcccacaaagtgggccgtcggggatcagcgcacagag
ttcttgggagcagcgccgttggggccccctgtctctccaccccatgtctccaccttcaag
acaaggtctgcaaagggttttggggctcgaggcccagacgtgctgagtccggccatggta
gccctctccaacaagctgaagctgaagcgacagctggagtatgaagagcaagccttccag
gacctgagcgggggggacccacctggtggcagcacctcacatttgatgtggaaacggatg
aagaacctcaggggtgggagctgccctttgatgccggacaagccactgagcgcaaatgta
cccaatgataagttcacccaaaaccccatgaggggcctgggccatcccctgagacatctg
ccgctgccacagcctccatctgccatcagtcccggggagaacagcaagagcaggttcccc
ccacagtgctacgccacccagtaccaggactacagcctgtcgtcagcccacaaggtgtca
ggcatggcaagccggctgctcgggccctcatttgagtcctacctgctgcccgaactgacc
agatatgactgtgaggtgaacgtgcccgtgctgggaagctccacgctcctgcaaggaggg
gacctcctcagagccctggaccaggccacctga

DBGET integrated database retrieval system