KEGG   Homo sapiens (human): 203447Help
Entry
203447            CDS       T01001                                 

Gene name
NRK, NESK
Definition
(RefSeq) Nik related kinase (EC:2.7.11.1)
  KO
K16313  
Nik-related protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     203447 (NRK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   203447 (NRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.3
AA seq 1582 aa AA seqDB search
MAGPGGWRDREVTDLGHLPDPTGIFSLDKTIGLGTYGRIYLGLHEKTGAFTAVKVMNARK
TPLPEIGRRVRVNKYQKSVGWRYSDEEEDLRTELNLLRKYSFHKNIVSFYGAFFKLSPPG
QRHQLWMVMELCAAGSVTDVVRMTSNQSLKEDWIAYICREILQGLAHLHAHRVIHRDIKG
QNVLLTHNAEVKLVDFGVSAQVSRTNGRRNSFIGTPYWMAPEVIDCDEDPRRSYDYRSDV
WSVGITAIEMAEGAPPLCNLQPLEALFVILRESAPTVKSSGWSRKFHNFMEKCTIKNFLF
RPTSANMLQHPFVRDIKNERHVVESLTRHLTGIIKKRQKKGIPLIFEREEAIKEQYTVRR
FRGPSCTHELLRLPTSSRCRPLRVLHGEPSQPRWLPDREEPQVQALQQLQGAARVFMPLQ
ALDSAPKPLKGQAQAPQRLQGAARVFMPLQAQVKAKASKPLQMQIKAPPRLRRAARVLMP
LQAQVRAPRLLQVQSQVSKKQQAQTQTSEPQDLDQVPEEFQGQDQVPEQQRQGQAPEQQQ
RHNQVPEQELEQNQAPEQPEVQEQAAEPAQAETEAEEPESLRVNAQVFLPLLSQDHHVLL
PLHLDTQVLIPVEGQTEGSPQAQAWTLEPPQAIGSVQALIEGLSRDLLRAPNSNNSKPLG
PLQTLMENLSSNRFYSQPEQAREKKSKVSTLRQALAKRLSPKRFRAKSSWRPEKLELSDL
EARRQRRQRRWEDIFNQHEEELRQVDKDKEDESSDNDEVFHSIQAEVQIEPLKPYISNPK
KIEVQERSPSVPNNQDHAHHVKFSSSVPQRSLLEQAQKPIDIRQRSSQNRQNWLAASESS
SEEESPVTGRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPPVYLTNEWVGYNALSEIF
RNDWLTPAPVIQPPEEDGDYVELYDASADTDGDDDDESNDTFEDTYDHANGNDDLDNQVD
QANDVCKDHDDDNNKFVDDVNNNYYEAPSCPRASYGRDGSCKQDGYDGSRGKEEAYRGYG
SHTANRSHGGSAASEDNAAIGDQEEHAANIGSERRGSEGDGGKGVVRTSEESGALGLNGE
ENCSETDGPGLKRPASQDFEYLQEEPGGGNEASNAIDSGAAPSAPDHESDNKDISESSTQ
SDFSANHSSPSKGSGMSADANFASAILYAGFVEVPEESPKQPSEVNVNPLYVSPACKKPL
IHMYEKEFTSEICCGSLWGVNLLLGTRSNLYLMDRSGKADITKLIRRRPFRQIQVLEPLN
LLITISGHKNRLRVYHLTWLRNKILNNDPESKRRQEEMLKTEEACKAIDKLTGCEHFSVL
QHEETTYIAIALKSSIHLYAWAPKSFDESTAIKVCIDQSADSEGDYMSYQAYIRILAKIQ
AADPVNRFKRPDELLHLLKLKVFPTLDHKPVTVDLAIGSEKRLKIFFSSADGYHLIDAES
EVMSDVTLPKNPLEIIIPQNIIILPDCLGIGMMLTFNAEALSVEANEQLFKKILEMWKDI
PSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRN
HHSRVYFMTLGKLEELQSNYDV
NT seq 4749 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacctgggggctggagggacagggaggtcacggatctgggccacctgccggat
ccaactggaatattctcactagataaaaccattggccttggtacttatggcagaatctat
ttgggacttcatgagaagactggtgcatttacagctgttaaagtgatgaacgctcgtaag
acccctttacctgaaataggaaggcgagtgagagtgaataaatatcaaaaatctgttggg
tggagatacagtgatgaggaagaggatctcaggactgaactcaaccttctgaggaagtac
tctttccacaaaaacattgtgtccttctatggagcatttttcaagctgagtccccctggt
cagcggcaccaactttggatggtgatggagttatgtgcagcaggttcggtcactgatgta
gtgagaatgaccagtaatcagagtttaaaagaagattggattgcttatatctgccgagaa
atccttcagggcttagctcaccttcacgcacaccgagtaattcaccgggacatcaaaggt
cagaatgtgctgctgactcataatgctgaagtaaaactggttgattttggagtgagtgcc
caggtgagcagaactaatggaagaaggaatagtttcattgggacaccatactggatggca
cctgaggtgattgactgtgatgaggacccaagacgctcctatgattacagaagtgatgtg
tggtctgtgggaattactgccattgaaatggctgaaggagcccctcctctgtgtaacctt
caacccttggaagctctcttcgttattttgcgggaatctgctcccacagtcaaatccagc
ggatggtcccgtaagttccacaatttcatggaaaagtgtacgataaaaaatttcctgttt
cgtcctacttctgcaaacatgcttcaacacccatttgttcgggatataaaaaatgaacga
catgttgttgagtcattaacaaggcatcttactggaatcattaaaaaaagacagaaaaaa
ggaatacctttgatctttgaaagagaagaagctattaaggaacagtacaccgtgagaaga
ttcagaggaccctcttgcactcacgagcttctgagattgccaaccagcagcagatgcaga
ccacttagagtcctgcatggggaaccctctcagccaaggtggctacctgatcgagaagag
ccacaggtccaggcacttcagcagctacagggagcagccagggtattcatgccactgcag
gctctggacagtgcacctaagcctctaaaggggcaggctcaggcacctcaacgactacaa
ggggcagctcgggtgttcatgccactacaggctcaggtgaaggctaaggcctctaaacct
ctacaaatgcagattaaggcacctccacgactacggagggcagccagggtgctcatgcca
ctacaggcacaggttagggcacctaggcttctgcaggtacagtcccaggtatccaaaaag
cagcaggcccagacccagacatcagaaccacaagatttggaccaggtaccagaggaattt
cagggtcaagatcaggtacccgaacaacaaaggcagggccaggcccctgaacaacagcag
aggcacaaccaggtgcctgaacaagagctggagcagaaccaggcacctgaacagccagag
gtacaggaacaggctgccgagcctgcacaggcagagactgaggcagaggaacctgagtca
ttacgagtaaatgcccaggtatttctgcccctgctatcacaagatcaccatgtgctgttg
ccactacatttggatactcaggtgctcattccagtagaggggcaaactgaaggatcacct
caggcacaggcttggacactagaacccccacaggcaattggctcagttcaagcactgata
gagggactatcaagagacttgcttcgggcaccaaactcaaataactcaaagccacttggt
ccgttgcaaaccctgatggaaaatctgtcatcaaataggttttactcacaaccagaacag
gcacgggagaaaaaatcaaaagtttctactctgaggcaagcactggcaaaaagactatca
ccaaagaggttcagggcaaagtcatcatggagacctgaaaagcttgaactctcggattta
gaagcccgcaggcaaaggcgccaacgcagatgggaagatatctttaatcagcatgaggaa
gaattgagacaagttgataaagacaaagaagatgaatcatcagacaatgatgaagtattt
cattcgattcaggctgaagtccagatagagccattgaagccatacatttcaaatcctaaa
aaaattgaggttcaagagagatctccttctgtgcctaacaaccaggatcatgcacatcat
gtcaagttctcttcaagcgttcctcagcggtctcttttggaacaagctcagaagcccatt
gacatcagacaaaggagttcgcaaaatcgtcaaaattggctggcagcatcagaatcttct
tctgaggaagaaagtcctgtgactggaaggaggtctcagtcatcaccaccttattctact
attgatcagaagttgctggttgacatccatgttccagatggatttaaagtaggaaaaata
tcaccccctgtatacttgacaaacgaatgggtaggctataatgcactctctgaaatcttc
cggaatgattggttaactccggcacctgtcattcagccacctgaagaggatggtgattat
gttgaactctatgatgccagtgctgatactgatggtgatgatgatgatgagtctaatgat
acttttgaagatacctatgatcatgccaatggcaatgatgacttggataaccaggttgat
caggctaatgatgtttgtaaagaccatgatgatgacaacaataagtttgttgatgatgta
aataataattattatgaggcgcctagttgtccaagggcaagctatggcagagatggaagc
tgcaagcaagatggttatgatggaagtcgtggaaaagaggaagcctacagaggctatgga
agccatacagccaatagaagccatggaggaagtgcagccagtgaggacaatgcagccatt
ggagatcaggaagaacatgcagccaatataggcagtgaaagaagaggcagtgagggtgat
ggaggtaagggagtcgttcgaaccagtgaagagagtggagcccttggactcaatggagaa
gaaaattgctcagagacagatggtccaggattgaagagacctgcgtctcaggactttgaa
tatctacaggaggagccaggtggtggaaatgaggcctcaaatgccattgactcaggtgct
gcaccgtcagcacctgatcatgagagtgacaataaggacatatcagaatcatcaacacaa
tcagatttttctgccaatcactcatctccttccaaaggttctgggatgtctgctgatgct
aactttgccagtgccatcttatacgctggattcgtagaagtacctgaggaatcacctaag
caaccctctgaagtcaatgttaacccactctatgtctctcctgcatgtaaaaaaccacta
atccacatgtatgaaaaggagttcacttctgagatctgctgtggttctttgtggggagtc
aatttgctgttgggaacccgatctaatctatatctgatggacagaagtggaaaggctgac
attactaaacttataaggcgaagaccattccgccagattcaagtcttagagccactcaat
ttgctgattaccatctcaggtcataagaacagacttcgggtgtatcatctgacctggttg
aggaacaagattttgaataatgatccagaaagtaaaagaaggcaagaagaaatgctgaag
acagaggaagcctgcaaagctattgataagttaacaggctgtgaacacttcagtgtcctc
caacatgaagaaacaacatatattgcaattgctttgaaatcatcaattcacctttatgca
tgggcaccaaagtcctttgatgaaagcactgctattaaagtatgcattgatcaatcagca
gactctgaaggagactacatgtcctatcaagcctatatacgaatactggcaaaaatacag
gcagctgatccagtgaaccggtttaagagaccagatgagctccttcatttgctgaagctc
aaggtatttccaacacttgatcataagccagtgacagttgacctggctattggttctgaa
aaaagactaaagattttcttcagctcagcagatggatatcacctcatcgatgcagaatct
gaggttatgtctgatgtgaccctgccaaagaatcccctggaaatcattataccacagaat
atcatcattttacctgattgcttgggaattggcatgatgctcaccttcaatgctgaagcc
ctctctgtggaagcaaatgaacaactcttcaagaagatccttgaaatgtggaaagacata
ccatcttctatagcttttgaatgtacacagcgaaccacaggatggggccaaaaggccatt
gaagtgcgctctttgcaatccagggttctggaaagtgagctgaagcgcaggtcaattaag
aagctgagattcctgtgcacccggggtgacaagctgttctttacctctaccctgcgcaat
caccacagccgggtttacttcatgacacttggaaaacttgaagagctccaaagcaattat
gatgtctaa

DBGET integrated database retrieval system