KEGG   Homo sapiens (human): 2035Help
Entry
2035              CDS       T01001                                 

Gene name
EPB41, 4.1R, EL1, HE
Definition
(RefSeq) erythrocyte membrane protein band 4.1
  KO
K06107  
erythrocyte membrane protein band 4.1
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H00231  
Hereditary elliptocytosis (HE)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    2035 (EPB41)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     2035 (EPB41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p33-p32
AA seq 864 aa AA seqDB search
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECS
KIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRAS
RSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKED
EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNIN
GQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLD
PGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEIADE
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagagaagagtttagtgactgaggccgaaaattcacagcaccaacagaaggaa
gagggtgaggaagccataaactcaggccaacaagaacctcagcaggaggaatcttgtcaa
acagcagctgaaggagataattggtgtgaacagaagctgaaagcttctaatggagacact
cctacacatgaagacttgaccaagaacaaggagcggacatcagaaagcagaggactttca
cgactattctcctcgtttctcaaaaggcccaaatctcaggtgtccgaggaagaaggcaaa
gaagtagagtcagataaagaaaaaggtgaaggaggtcagaaagagatagaatttggaacc
agtcttgatgaagagatcattttaaaggccccaattgcagctcctgaaccggaactcaaa
acagacccatctttggatcttcattcattaagcagtgcagaaacacagcctgctcaggaa
gaactcagagaagatccagattttgaaattaaggaaggagaaggacttgaagagtgctcc
aaaatagaagtaaaagaagaaagccctcaatcaaaagcagaaacagaattaaaagcttcc
caaaaaccaatcagaaaacacaggaacatgcactgcaaggtttctttgttggatgacaca
gtttatgaatgtgttgtggagaaacatgctaagggacaagatttgcttaaacgagtatgt
gagcatctcaatcttttggaagaagactattttggtctagccatttgggataacgcaacc
tctaagacatggctggattccgccaaagaaataaaaaagcaggttcgtggtgtcccttgg
aattttacatttaatgtaaagttttatccacctgacccagcacagttaacagaagacata
acaagatattatttatgtcttcagcttcggcaggacatagttgcaggacgtctgccctgt
tcctttgcaaccttagcattattaggttcttacaccatccagtctgaactgggagactac
gacccagaactccatggcgtggattatgttagtgattttaaactggccccgaatcagacc
aaggaacttgaagagaaggtcatggaactgcataagtcatacaggtccatgactccagct
caggctgacttggagtttcttgagaatgccaaaaagttgtctatgtatggagttgatctt
cataaagcaaaggacttggaaggagtagatatcatcctaggtgtctgctctagtggcctt
ctggtttacaaagataagctgagaattaaccgcttcccttggcccaaagtgctgaagatt
tcttataaacgtagtagctttttcatcaagattcggcctggagagcaagagcagtatgaa
agtaccatcggattcaaacttcccagttaccgagcagctaagaaattatggaaagtctgt
gtagaacatcacacgtttttcagattgacatctacagacaccattcccaaaagcaaattt
cttgcgctaggatccaaatttcgatacagtggccggactcaagctcagaccaggcaagct
agtgctctaattgacaggcctgccccacacttcgagcgtacagcaagtaaacgggcgtcc
cggagcctcgatggagcagcagctgtcgattcggcagaccgaagtcctcggcccacttct
gcacctgccattactcagggtcaggttgcagaaggtggcgtcctagatgcctctgctaaa
aaaacagtggtccctaaagcacagaaggaaacagtgaaggctgaagtgaaaaaggaagac
gagccacctgagcaagctgagccagagcccacagaagcatggaaggtggaaaaaacccac
atcgaggtgacagtacccacctcaaatggtgaccaaacacagaagcttgcagaaaaaact
gaagatctgataagaatgaggaagaaaaagagagaaagactagatggtgaaaacatttat
atcagacatagcaatttaatgttggaggatttagacaagagtcaagaggagatcaaaaaa
catcatgccagcatcagtgagctgaaaaagaacttcatggagtctgtaccagaaccacgg
cctagtgaatgggataaacgcttatccactcactcacccttccgaactcttaacatcaat
gggcaaatccccacaggagaaggacctcccctggtgaagacacaaactgtcaccatctca
gataatgccaatgctgtgaaaagtgaaatcccaaccaaagacgtccctattgtccacact
gagaccaagaccatcacttatgaggctgcccagactgacgacaacagtggagacttggac
ccaggagtcttgctgacagctcaaactatcacatctgagaccccaagcagcaccaccaca
actcaaattaccaagactgtaaaaggtgggatttcagagacacgtattgaaaagagaatt
gtgatcacaggagatgctgatattgaccatgatcaggtccttgtacaagccatcaaggag
gcaaaggagcagcacccagacatgtcagtgaccaaggtggtcgtccaccaggagaccgag
attgctgatgagtga

DBGET integrated database retrieval system