KEGG   Homo sapiens (human): 203547Help
Entry
203547            CDS       T01001                                 

Gene name
VMA21, MEAX, XMEA
Definition
VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 101 aa AA seqDB search
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS
NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcccggataaggcggcgctgaacgcactgcagcctcctgagttcagaaatgaa
agctcattagcatctacactgaagacgctcctgttcttcacagctttaatgatcactgtt
cctattgggttatatttcacaactaaatcttacatatttgaaggcgcccttgggatgtcc
aatagggacagctatttttacgctgctattgttgcagtggtcgccgtccatgtggtgctg
gccctctttgtgtatgtggcctggaatgaaggctcacgacagtggcgtgaaggcaaacag
gattaa

DBGET integrated database retrieval system