KEGG   Homo sapiens (human): 203547Help
Entry
203547            CDS       T01001                                 

Gene name
VMA21, MEAX, XMEA
Definition
(RefSeq) VMA21, vacuolar ATPase assembly factor
Organism
hsa  Homo sapiens (human)
Disease
H01781  
Autophagic vacuolar myopathy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q3ZAQ7(Tbio)
UniProt: 
Position
Xq28
AA seq 101 aa AA seqDB search
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS
NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcccggataaggcggcgctgaacgcactgcagcctcctgagttcagaaatgaa
agctcattagcatctacactgaagacgctcctgttcttcacagctttaatgatcactgtt
cctattgggttatatttcacaactaaatcttacatatttgaaggcgcccttgggatgtcc
aatagggacagctatttttacgctgctattgttgcagtggtcgccgtccatgtggtgctg
gccctctttgtgtatgtggcctggaatgaaggctcacgacagtggcgtgaaggcaaacag
gattaa

DBGET integrated database retrieval system