KEGG   Homo sapiens (human): 2038Help
Entry
2038              CDS       T01001                                 

Gene name
EPB42, PA, SPH5
Definition
(RefSeq) erythrocyte membrane protein band 4.2
Organism
hsa  Homo sapiens (human)
Disease
H00230  
Hereditary spherocytosis (SPH)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15-q21
AA seq 691 aa AA seqDB search
MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVA
LTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLL
LQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWD
FGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGA
LLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGG
RLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVL
GSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNIST
KGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLK
APSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLE
KIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQ
YQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVG
LQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggccctgggtatcaagagctgtgactttcaggcagcaagaaacaatgaggag
caccacaccaaggccctcagctcccggcgcctctttgtgaggagggggcagcccttcacc
atcatcctgtacttccgcgctccagtccgtgcatttctgcctgccctgaagaaggtggcc
ctcactgcacaaactggagagcagccttccaagatcaacaggacccaagccacattccca
atttccagtctgggggaccgaaagtggtggagtgcagtggtggaggagagagatgcccag
tcctggaccatctctgtgaccacacctgcggacgctgtcattggccactactcgcttctg
ctgcaggtctcaggcaggaagcaactcctcttgggtcagttcacactgctttttaacccc
tggaatagagaggatgctgtgttcctgaagaatgaggctcagcgcatggagtacttgttg
aaccagaatggtctcatctacctgggtacagctgactgcatccaggcagagtcctgggac
tttggccagttcgagggggatgtcattgacctcagcctgcgcttgctgagcaaggacaag
caggtagagaagtggagccagccggtgcacgtggcccgtgtgttgggtgccttgctgcat
tttctcaaggagcagagggtcctgcccaccccgcagacccaggccacccaggaaggggcc
ttgctgaacaagcgccggggcagcgtgcccatcctgcggcagtggctcaccggccgaggc
cgacctgtgtatgatggccaggcctgggtgttggctgctgttgcttgcacagtgctgcga
tgcctgggaatccctgcccgcgtggtgaccacgtttgcctcagcacagggcaccggtggg
cgtcttctcatagatgaatactataatgaggagggacttcagaacggagaaggccagaga
ggcagaatctggatcttccagacttccacagagtgctggatgacgcggcctgccttgccc
cagggttatgatggatggcagattctgcacccaagtgctcctaatggaggtggagtcctg
gggtcctgtgatctggtgccggtcagagcagtcaaggaggggacgctggggctgacccca
gcagtgtcagacctttttgctgccataaatgcctcatgtgtggtctggaagtgctgtgag
gatgggacactggagttgactgactccaacacaaagtatgttggcaacaacatcagcacc
aagggtgtgggcagtgaccgctgcgaggacatcactcagaactacaagtatcctgaaggg
tctcttcaggaaaaagaggtgctggagagagtcgagaaagagaaaatggaacgtgagaaa
gacaacggcatccgtcctcccagtctcgagactgccagtcctctgtacctgctcttgaaa
gcacccagctccctacccctgagaggggatgcccagatctcagtgacgctggttaatcac
agtgagcaggagaaggcagtgcagctggcaattggggtccaggctgtacactacaacggt
gtccttgctgccaagctctggaggaagaagctgcacctcacgctcagtgccaacctggaa
aagataataaccatcggcctgttcttctccaattttgagcgaaacccacccgagaacacc
ttccttagactcaccgccatggcaacacactctgaatccaaccttagctgctttgctcag
gaagacattgccatttgtagaccacaccttgccatcaagatgccagagaaagcagagcag
tatcaacccctcacagcctcagtcagcctccagaactccctagatgcccccatggaggac
tgtgtgatctccatcctgggaagggggctcattcacagagagaggagctacagattccgt
tcagtgtggcctgaaaacaccatgtgtgccaagttccagttcacgccaacacatgtgggg
ctccagagactcactgtggaagtggactgcaacatgttccagaacctaaccaactataaa
agcgtcaccgtggtagcccctgaactatcagcttaa

DBGET integrated database retrieval system