KEGG   Homo sapiens (human): 2038Help
Entry
2038              CDS       T01001                                 

Gene name
EPB42, PA, SPH5
Definition
erythrocyte membrane protein band 4.2
Organism
hsa  Homo sapiens (human)
Disease
H00230  
Hereditary spherocytosis (SPH)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15-q21
AA seq 721 aa AA seqDB search
MGQGEPSQRSTGLAGLYAAPAASPVFIKGSGMDALGIKSCDFQAARNNEEHHTKALSSRR
LFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWW
SAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLK
NEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVH
VARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWV
LAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTST
ECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAIN
ASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLER
VEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLA
IGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATH
SESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGL
IHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELS
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggacagggtgagccaagccagcgctcgacagggcttgctggactgtatgcagccccc
gcagcatcacctgttttcattaaaggaagtgggatggatgccctgggtatcaagagctgt
gactttcaggcagcaagaaacaatgaggagcaccacaccaaggccctcagctcccggcgc
ctctttgtgaggagggggcagcccttcaccatcatcctgtacttccgcgctccagtccgt
gcatttctgcctgccctgaagaaggtggccctcactgcacaaactggagagcagccttcc
aagatcaacaggacccaagccacattcccaatttccagtctgggggaccgaaagtggtgg
agtgcagtggtggaggagagagatgcccagtcctggaccatctctgtgaccacacctgcg
gacgctgtcattggccactactcgcttctgctgcaggtctcaggcaggaagcaactcctc
ttgggtcagttcacactgctttttaacccctggaatagagaggatgctgtgttcctgaag
aatgaggctcagcgcatggagtacttgttgaaccagaatggtctcatctacctgggtaca
gctgactgcatccaggcagagtcctgggactttggccagttcgagggggatgtcattgac
ctcagcctgcgcttgctgagcaaggacaagcaggtagagaagtggagccagccggtgcac
gtggcccgtgtgttgggtgccttgctgcattttctcaaggagcagagggtcctgcccacc
ccgcagacccaggccacccaggaaggggccttgctgaacaagcgccggggcagcgtgccc
atcctgcggcagtggctcaccggccgaggccgacctgtgtatgatggccaggcctgggtg
ttggctgctgttgcttgcacagtgctgcgatgcctgggaatccctgcccgcgtggtgacc
acgtttgcctcagcacagggcaccggtgggcgtcttctcatagatgaatactataatgag
gagggacttcagaacggagaaggccagagaggcagaatctggatcttccagacttccaca
gagtgctggatgacgcggcctgccttgccccagggttatgatggatggcagattctgcac
ccaagtgctcctaatggaggtggagtcctggggtcctgtgatctggtgccggtcagagca
gtcaaggaggggacgctggggctgaccccagcagtgtcagacctttttgctgccataaat
gcctcatgtgtggtctggaagtgctgtgaggatgggacactggagttgactgactccaac
acaaagtatgttggcaacaacatcagcaccaagggtgtgggcagtgaccgctgcgaggac
atcactcagaactacaagtatcctgaagggtctcttcaggaaaaagaggtgctggagaga
gtcgagaaagagaaaatggaacgtgagaaagacaacggcatccgtcctcccagtctcgag
actgccagtcctctgtacctgctcttgaaagcacccagctccctacccctgagaggggat
gcccagatctcagtgacgctggttaatcacagtgagcaggagaaggcagtgcagctggca
attggggtccaggctgtacactacaacggtgtccttgctgccaagctctggaggaagaag
ctgcacctcacgctcagtgccaacctggaaaagataataaccatcggcctgttcttctcc
aattttgagcgaaacccacccgagaacaccttccttagactcaccgccatggcaacacac
tctgaatccaaccttagctgctttgctcaggaagacattgccatttgtagaccacacctt
gccatcaagatgccagagaaagcagagcagtatcaacccctcacagcctcagtcagcctc
cagaactccctagatgcccccatggaggactgtgtgatctccatcctgggaagggggctc
attcacagagagaggagctacagattccgttcagtgtggcctgaaaacaccatgtgtgcc
aagttccagttcacgccaacacatgtggggctccagagactcactgtggaagtggactgc
aacatgttccagaacctaaccaactataaaagcgtcaccgtggtagcccctgaactatca
gcttaa

DBGET integrated database retrieval system