KEGG   Homo sapiens (human): 204Help
Entry
204               CDS       T01001                                 

Gene name
AK2, ADK2, AK_2
Definition
adenylate kinase 2 (EC:2.7.4.3)
Orthology
K00939  
adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
H01128  
Reticular dysgenesis
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34
AA seq 224 aa AA seqDB search
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQ
AYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcgtgccagcggcagaacccgagtatcctaaaggcatccgggccgtgctg
ctggggcctcccggggccggtaaagggacccaggcacccagattggctgaaaacttctgt
gtctgccatttagctactggggacatgctgagggccatggtggcttctggctcagagcta
ggaaaaaagctgaaggcaactatggatgctgggaaactggtgagtgatgaaatggtagtg
gagctcattgagaagaatttggagacccccttgtgcaaaaatggttttcttctggatggc
ttccctcggactgtgaggcaggcagaaatgctcgatgacctcatggagaagaggaaagag
aagcttgattctgtgattgaattcagcatcccagactctctgctgattcaccccaagagt
ggccgttcctaccacgaggagttcaaccctccaaaagagcccatgaaagatgacatcacc
ggggaacccttgatccgtcgatcagatgataatgaaaaggccttgaaaatccgcctgcaa
gcctaccacactcaaaccaccccactcatagagtactacaggaaacgggggatccactcc
gccatcgatgcatcccagacccccgatgtcgtgttcgcaagcatcctagcagccttctcc
aaagccacatcctag

DBGET integrated database retrieval system