KEGG   Homo sapiens (human): 204Help
Entry
204               CDS       T01001                                 

Gene name
AK2, ADK2, AK_2
Definition
adenylate kinase 2 (EC:2.7.4.3)
Orthology
K00939  
adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
H01128  
Reticular dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    204 (AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     204 (AK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   204 (AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34
AA seq 224 aa AA seqDB search
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQ
AYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcgtgccagcggcagaacccgagtatcctaaaggcatccgggccgtgctg
ctggggcctcccggggccggtaaagggacccaggcacccagattggctgaaaacttctgt
gtctgccatttagctactggggacatgctgagggccatggtggcttctggctcagagcta
ggaaaaaagctgaaggcaactatggatgctgggaaactggtgagtgatgaaatggtagtg
gagctcattgagaagaatttggagacccccttgtgcaaaaatggttttcttctggatggc
ttccctcggactgtgaggcaggcagaaatgctcgatgacctcatggagaagaggaaagag
aagcttgattctgtgattgaattcagcatcccagactctctgctgattcaccccaagagt
ggccgttcctaccacgaggagttcaaccctccaaaagagcccatgaaagatgacatcacc
ggggaacccttgatccgtcgatcagatgataatgaaaaggccttgaaaatccgcctgcaa
gcctaccacactcaaaccaccccactcatagagtactacaggaaacgggggatccactcc
gccatcgatgcatcccagacccccgatgtcgtgttcgcaagcatcctagcagccttctcc
aaagccacatcctag

DBGET integrated database retrieval system