KEGG   Homo sapiens (human): 2045Help
Entry
2045              CDS       T01001                                 

Gene name
EPHA7, EHK-3, EHK3, EK11, HEK11
Definition
(RefSeq) EPH receptor A7
  KO
K05108  
EphA7 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2045 (EPHA7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2045 (EPHA7)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Eph family
   2045 (EPHA7)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   2045 (EPHA7)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   2045 (EPHA7)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EFNA; ephrin-A [KO:K05462]
   2045 (EPHA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q16.1
AA seq 998 aa AA seqDB search
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcaaactcggtacccttcatggattattttatgctacatctggctgctccgc
tttgcacacacaggggaggcgcaggctgcgaaggaagtactactgctggattctaaagca
caacaaacagagttggagtggatttcctctccacccaatgggtgggaagaaattagtggt
ttggatgagaactataccccgatacgaacataccaggtgtgccaagtcatggagcccaac
caaaacaactggctgcggactaactggatttccaaaggcaatgcacaaaggatttttgta
gaattgaaattcaccctgagggattgtaacagtcttcctggagtactgggaacttgcaag
gaaacatttaatttgtactattatgaaacagactatgacactggcaggaatataagagaa
aacctctatgtaaaaatagacaccattgctgcagatgaaagttttacccaaggtgacctt
ggtgaaagaaagatgaagcttaacactgaggtgagagagattggacctttgtccaaaaag
ggattctatcttgcctttcaggatgtaggggcttgcatagctttggtttctgtcaaagtg
tactacaagaagtgctggtccattattgagaacttagctatctttccagatacagtgact
ggttcagaattttcctctttagtcgaggttcgagggacatgtgtcagcagtgcagaggaa
gaagcggaaaacgcccccaggatgcactgcagtgcagaaggagaatggttagtgcccatt
ggaaaatgtatctgcaaagcaggctaccagcaaaaaggagacacttgtgaaccctgtggc
cgtgggttctacaagtcttcctctcaagatcttcagtgctctcgttgtccaactcacagt
ttttctgataaagaaggctcctccagatgtgaatgtgaagatgggtattacagggctcca
tctgacccaccatacgttgcgtgcacaaggcctccatctgcaccacagaacctcattttc
aacatcaaccaaaccacagtaagtttggaatggagtcctcctgcagacaatgggggaaga
aacgatgtgacctacagaatattgtgtaagcggtgcagttgggagcagggcgaatgtgtt
ccctgtgggagtaacattggatacatgccccagcagactggattagaggataactatgtc
actgtcatggacctgctagcccacgctaattatacttttgaagttgaagctgtaaatgga
gtttctgacttaagccgatcccagaggctctttgctgctgtcagtatcaccactggtcaa
gcagctccctcgcaagtgagtggagtaatgaaggagagagtactgcagcggagtgtcgag
ctttcctggcaggaaccagagcatcccaatggagtcatcacagaatatgaaatcaagtat
tacgagaaagatcaaagggaacggacctactcaacagtaaaaaccaagtctacttcagcc
tccattaataatctgaaaccaggaacagtgtatgttttccagattcgggcttttactgct
gctggttatggaaattacagtcccagacttgatgttgctacactagaggaagctacaggt
aaaatgtttgaagctacagctgtctccagtgaacagaatcctgttattatcattgctgtg
gttgctgtagctgggaccatcattttggtgttcatggtctttggcttcatcattgggaga
aggcactgtggttatagcaaagctgaccaagaaggcgatgaagagctttactttcatttt
aaatttccaggcaccaaaacctacattgaccctgaaacctatgaggacccaaatagagct
gtccatcaattcgccaaggagctagatgcctcctgtattaaaattgagcgtgtgattggt
gcaggagaattcggtgaagtctgcagtggccgtttgaaacttccagggaaaagagatgtt
gcagtagccataaaaaccctgaaagttggttacacagaaaaacaaaggagagactttttg
tgtgaagcaagcatcatggggcagtttgaccacccgaatgttgtccatttggaaggggtt
gttacaagagggaaaccagtcatgatagtaatagagttcatggaaaatggagccctagat
gcatttctcaggaaacatgatgggcaatttacagtcattcagttagtaggaatgctgaga
ggaattgctgctggaatgagatatttggctgatatgggatatgttcacagggaccttgca
gctcgcaatattcttgtcaacagcaatctcgtttgtaaagtgtcagattttggcctgtcc
cgagttatagaggatgatccagaagctgtctatacaactactggtggaaaaattccagta
aggtggacagcacccgaagccatccagtaccggaaattcacatcagccagtgatgtatgg
agctatggaatagtcatgtgggaagttatgtcttatggagaaagaccttattgggacatg
tcaaatcaagatgttataaaagcaatagaagaaggttatcgtttaccagcacccatggac
tgcccagctggccttcaccagctaatgttggattgttggcaaaaggagcgtgctgaaagg
ccaaaatttgaacagatagttggaattctagacaaaatgattcgaaacccaaatagtctg
aaaactcccctgggaacttgtagtaggccaataagccctcttctggatcaaaacactcct
gatttcactaccttttgttcagttggagaatggctacaagctattaagatggaaagatat
aaagataatttcacggcagctggctacaattcccttgaatcagtagccaggatgactatt
gaggatgtgatgagtttagggatcacactggttggtcatcaaaagaaaatcatgagcagc
attcagactatgagagcacaaatgctacatttacatggaactggcattcaagtgtga

DBGET integrated database retrieval system