KEGG   Homo sapiens (human): 2046Help
Entry
2046              CDS       T01001                                 

Gene name
EPHA8, EEK, EK3, HEK3
Definition
(RefSeq) EPH receptor A8
  KO
K05109  Eph receptor A8 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2046 (EPHA8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2046 (EPHA8)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2046 (EPHA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 SAM_2 EphA2_TM Pur_ac_phosph_N fn3_2 SusE Kdo Ephrin_rec_like Haspin_kinase Interfer-bind
Motif
Other DBs
NCBI-GeneID: 2046
NCBI-ProteinID: NP_065387
OMIM: 176945
HGNC: 3391
Ensembl: ENSG00000070886
Vega: OTTHUMG00000002892
Pharos: P29322(Tchem)
UniProt: P29322
Structure
PDB: 

Jmol
Position
1p36.12
AA seq 1005 aa AA seqDB search
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgcccggggccgcctgccccctgcgctctgggtcgtcacggccgcggcggcg
gcggccacctgcgtgtccgcggcgcgcggcgaagtgaatttgctggacacgtcgaccatc
cacggggactggggctggctcacgtatccggctcatgggtgggactccatcaacgaggtg
gacgagtccttccagcccatccacacgtaccaggtttgcaacgtcatgagccccaaccag
aacaactggctgcgcacgagctgggtcccccgagacggcgcccggcgcgtctatgctgag
atcaagtttaccctgcgcgactgcaacagcatgcctggtgtgctgggcacctgcaaggag
accttcaacctctactacctggagtcggaccgcgacctgggggccagcacacaagaaagc
cagttcctcaaaatcgacaccattgcggccgacgagagcttcacaggtgccgaccttggt
gtgcggcgtctcaagctcaacacggaggtgcgcagtgtgggtcccctcagcaagcgcggc
ttctacctggccttccaggacataggtgcctgcctggccatcctctctctccgcatctac
tataagaagtgccctgccatggtgcgcaatctggctgccttctcggaggcagtgacgggg
gccgactcgtcctcactggtggaggtgaggggccagtgcgtgcggcactcagaggagcgg
gacacacccaagatgtactgcagcgcggagggcgagtggctcgtgcccatcggcaaatgc
gtgtgcagtgccggctacgaggagcggcgggatgcctgtgtggcctgtgagctgggcttc
tacaagtcagcccctggggaccagctgtgtgcccgctgccctccccacagccactccgca
gctccagccgcccaagcctgccactgtgacctcagctactaccgtgcagccctggacccg
ccgtcctcagcctgcacccggccaccctcggcaccagtgaacctgatctccagtgtgaat
gggacatcagtgactctggagtgggcccctcccctggacccaggtggccgcagtgacatc
acctacaatgccgtgtgccgccgctgcccctgggcactgagccgctgcgaggcatgtggg
agcggcacccgctttgtgccccagcagacaagcctggtgcaggccagcctgctggtggcc
aacctgctggcccacatgaactactccttctggatcgaggccgtcaatggcgtgtccgac
ctgagccccgagccccgccgggccgctgtggtcaacatcaccacgaaccaggcagccccg
tcccaggtggtggtgatccgtcaagagcgggcggggcagaccagcgtctcgctgctgtgg
caggagcccgagcagccgaacggcatcatcctggagtatgagatcaagtactacgagaag
gacaaggagatgcagagctactccaccctcaaggccgtcaccaccagagccaccgtctcc
ggcctcaagccgggcacccgctacgtgttccaggtccgagcccgcacctcagcaggctgt
ggccgcttcagccaggccatggaggtggagaccgggaaaccccggccccgctatgacacc
aggaccattgtctggatctgcctgacgctcatcacgggcctggtggtgcttctgctcctg
ctcatctgcaagaagaggcactgtggctacagcaaggccttccaggactcggacgaggag
aagatgcactatcagaatggacaggcacccccacctgtcttcctgcctctgcatcacccc
ccgggaaagctcccagagccccagttctatgcggaaccccacacctacgaggagccaggc
cgggcgggccgcagtttcactcgggagatcgaggcctctaggatccacatcgagaaaatc
atcggctctggagactccggggaagtctgctacgggaggctgcgggtgccagggcagcgg
gatgtgcccgtggccatcaaggccctcaaagccggctacacggagagacagaggcgggac
ttcctgagcgaggcgtccatcatggggcaattcgaccatcccaacatcatccgcctcgag
ggtgtcgtcacccgtggccgcctggcaatgattgtgactgagtacatggagaacggctct
ctggacaccttcctgaggacccacgacgggcagttcaccatcatgcagctggtgggcatg
ctgagaggagtgggtgccggcatgcgctacctctcagacctgggctatgtccaccgagac
ctggccgcccgcaacgtcctggttgacagcaacctggtctgcaaggtgtctgacttcggg
ctctcacgggtgctggaggacgacccggatgctgcctacaccaccacgggcgggaagatc
cccatccgctggacggccccagaggccatcgccttccgcaccttctcctcggccagcgac
gtgtggagcttcggcgtggtcatgtgggaggtgctggcctatggggagcggccctactgg
aacatgaccaaccgggatgtcatcagctctgtggaggaggggtaccgcctgcccgcaccc
atgggctgcccccacgccctgcaccagctcatgctcgactgttggcacaaggaccgggcg
cagcggcctcgcttctcccagattgtcagtgtcctcgatgcgctcatccgcagccctgag
agtctcagggccaccgccacagtcagcaggtgcccaccccctgccttcgtccggagctgc
tttgacctccgagggggcagcggtggcggtgggggcctcaccgtgggggactggctggac
tccatccgcatgggccggtaccgagaccacttcgctgcgggcggatactcctctctgggc
atggtgctacgcatgaacgcccaggacgtgcgcgccctgggcatcaccctcatgggccac
cagaagaagatcctgggcagcattcagaccatgcgggcccagctgaccagcacccagggg
ccccgccggcacctctga

DBGET integrated database retrieval system