KEGG   Homo sapiens (human): 2047Help
Entry
2047              CDS       T01001                                 

Gene name
EPHB1, ELK, EPHT2, Hek6, NET
Definition
EPH receptor B1 (EC:2.7.10.1)
Orthology
K05110  
Eph receptor B1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21-q23
AA seq 984 aa AA seqDB search
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQISQSPTAMA
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggccctggattatctactactgctcctcctggcatccgcagtggctgcgatggaagaa
acgttaatggacaccagaacggctactgcagagctgggctggacggccaatcctgcgtcc
gggtgggaagaagtcagtggctacgatgaaaacctgaacaccatccgcacctaccaggtg
tgcaatgtcttcgagcccaaccagaacaattggctgctcaccaccttcatcaaccggcgg
ggggcccatcgcatctacacagagatgcgcttcactgtgagagactgcagcagcctccct
aatgtcccaggatcctgcaaggagaccttcaacttgtattactatgagactgactctgtc
attgccaccaagaagtcagccttctggtctgaggccccctacctcaaagtagacaccatt
gctgcagatgagagcttctcccaggtggactttgggggaaggctgatgaaggtaaacaca
gaagtcaggagctttgggcctcttactcggaatggtttttacctcgcttttcaggattat
ggagcctgtatgtctcttctttctgtccgtgtcttcttcaaaaagtgtcccagcattgtg
caaaattttgcagtgtttccagagactatgacaggggcagagagcacatctctggtgatt
gctcggggcacatgcatccccaacgcagaggaagtggacgtgcccatcaaactctactgc
aacggggatggggaatggatggtgcctattgggcgatgcacctgcaagcctggctatgag
cctgagaacagcgtggcatgcaaggcttgccctgcagggacattcaaggccagccaggaa
gctgaaggctgctcccactgcccctccaacagccgctcccctgcagaggcgtctcccatc
tgcacctgtcggaccggttattaccgagcggactttgaccctccagaagtggcatgcact
agcgtcccatcaggtccccgcaatgttatctccatcgtcaatgagacgtccatcattctg
gagtggcaccctccaagggagacaggtgggcgggatgatgtgacctacaacatcatctgc
aaaaagtgccgggcagaccgccggagctgctcccgctgtgacgacaatgtggagtttgtg
cccaggcagctgggcctgacggagtgccgcgtctccatcagcagcctgtgggcccacacc
ccctacacctttgacatccaggccatcaatggagtctccagcaagagtcccttcccccca
cagcacgtctctgtcaacatcaccacaaaccaagccgccccctccaccgttcccatcatg
caccaagtcagtgccactatgaggagcatcaccttgtcatggccacagccggagcagccc
aatggcatcatcctggactatgagatccggtactatgagaaggaacacaatgagttcaac
tcctccatggccaggagtcagaccaacacagcaaggattgatgggctgcggcctggcatg
gtatatgtggtacaggtgcgtgcccgcactgttgctggctacggcaagttcagtggcaag
atgtgcttccagactctgactgacgatgattacaagtcagagctgagggagcagctgccc
ctgattgctggctcggcagcggccggggtcgtgttcgttgtgtccttggtggccatctct
atcgtctgtagcaggaaacgggcttatagcaaagaggctgtgtacagcgataagctccag
cattacagcacaggccgaggctccccagggatgaagatctacattgaccccttcacttac
gaggatcccaacgaagctgtccgggagtttgccaaggagattgatgtatcttttgtgaaa
attgaagaggtcatcggagcaggggagtttggagaagtgtacaaggggcgtttgaaactg
ccaggcaagagggaaatctacgtggccatcaagaccctgaaggcagggtactcggagaag
cagcgtcgggactttctgagtgaggcgagcatcatgggccagttcgaccatcctaacatc
attcgcctggagggtgtggtcaccaagagtcggcctgtcatgatcatcacagagttcatg
gagaatggtgcattggattctttcctcaggcaaaatgacgggcagttcaccgtgatccag
cttgtgggtatgctcaggggcatcgctgctggcatgaagtacctggctgagatgaattat
gtgcatcgggacctggctgctaggaacattctggtcaacagtaacctggtgtgcaaggtg
tccgactttggcctctcccgctacctccaggatgacacctcagatcccacctacaccagc
tccttgggagggaagatccctgtgagatggacagctccagaggccatcgcctaccgcaag
ttcacttcagccagcgacgtttggagctatgggatcgtcatgtgggaagtcatgtcattt
ggagagagaccctattgggatatgtccaaccaagatgtcatcaatgccatcgagcaggac
taccggctgcccccacccatggactgtccagctgctctacaccagctcatgctggactgt
tggcagaaggaccggaacagccggccccggtttgcggagattgtcaacaccctagataag
atgatccggaacccggcaagtctcaagactgtggcaaccatcaccgccgtgccttcccag
cccctgctcgaccgctccatcccagacttcacggcctttaccaccgtggatgactggctc
agcgccatcaaaatggtccagtacagggacagcttcctcactgctggcttcacctccctc
cagctggtcacccagatgacatcagaagacctcctgagaataggcatcaccttggcaggc
catcagaagaagatcctgaacagcattcattctatgagggtccagataagtcagtcacca
acggcaatggcatga

DBGET integrated database retrieval system