KEGG   Homo sapiens (human): 204801Help
Entry
204801            CDS       T01001                                 

Gene name
NLRP11, CLR19.6, NALP11, NOD17, PAN10, PYPAF6, PYPAF7
Definition
(RefSeq) NLR family pyrin domain containing 11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.43
AA seq 1033 aa AA seqDB search
MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKILDFKLPQFPLIQMTKEELANVLPISY
EGQYIWNMLFSIFSMMRKEDLCRKIIGRRNRNQEACKAVMRRKFMLQWESHTFGKFHYKF
FRDVSSDVFYILQLAYDSTSYYSANNLNVFLMGERASGKTIVINLAVLRWIKGEMWQNMI
SYVVHLTAHEINQMTNSSLAELIAKDWPDGQAPIADILSDPKKLLFILEDLDNIRFELNV
NESALCSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRPTRGNNVKTFLKEVDCCTTLQL
SNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVAILCWITCTVLKRQMDKGRDFQ
LCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCV
GFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTAIAFLMAVPNYLIPSGSREYKE
KREQYSDFNQVFTFIFGLLNANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLT
HHMPLFYCLYENREEEFVKTIVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQR
IFQNKEPLIRPTASQMKSLVYWREICSLFYTMESLRELHIFDNDLNGISERILSKALEHS
SCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQI
SHLSLMKCDLRASECEEIASLLISGGSLRKLTLSSNPLRSDGMNILCDALLHPNCTLISL
VLVFCCLTENCCSALGRVLLFSPTLRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLS
GCFFSSDICQYIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGGLRHPNCMLVNIGLEECM
LTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPDCVLKVVGLPLTGLNT
QTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSA
AMRTSNTASRQPL
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcggattctactgactttgacctgctgtggtatctagagaatctcagtgac
aaggaatttcagagttttaagaagtatctggcacgcaagattcttgatttcaaactgcca
cagtttccactgatacagatgacaaaagaagaactggctaacgtgttgccaatctcttat
gagggacagtatatatggaatatgctcttcagcatattttcaatgatgcgtaaggaagat
ctttgtaggaagatcattggcagacgaaaccgcaatcaggaggcatgcaaagctgtcatg
aggagaaaattcatgctgcaatgggaaagtcacacttttggaaaatttcattataaattt
tttcgtgacgtttcgtcagatgtgttctacatacttcaattagcctatgattctaccagc
tattattcagcaaacaatctcaatgtgttcctgatgggagagagagcatctggaaaaact
attgttataaatctggctgtgttgaggtggatcaagggtgagatgtggcagaacatgatc
tcgtacgtcgttcacctcactgctcacgaaataaaccagatgaccaacagcagcttggct
gagctaatcgccaaggactggcctgacggccaggctcccattgcagacatcctgtctgat
cccaagaaactccttttcatcctcgaggacttggacaacataagattcgagttaaatgtc
aatgaaagtgctttgtgtagtaacagcacccagaaagttcccattccagttctcctggtc
agtttgctgaagagaaaaatggctccaggctgctggttcctcatctcctcaaggcccaca
cgtgggaataatgtaaaaacgttcttgaaagaggtagattgctgcacgaccttgcagctg
tcgaatgggaagagggagatatattttaactctttctttaaagaccgccagagggcgtcg
gcagccctccagcttgtacatgaggatgaaatactcgtgggtctgtgccgagtcgccatc
ttatgctggatcacgtgtactgtcctgaagcggcagatggacaaggggcgtgacttccag
ctctgctgccaaacacccactgatctacatgcccactttcttgctgatgcgttgacatca
gaggctggacttactgccaatcagtatcacctaggtctcctaaaacgtctgtgtttgctg
gctgcaggaggactgtttctgagcaccctgaatttcagtggtgaagacctcagatgtgtt
gggtttactgaggctgatgtctctgtgttgcaggccgcgaatattcttttgccgagcaac
actcataaagaccgttacaagttcatacacttgaacgtccaggagttttgtacagccatt
gcatttctgatggcagtacccaactatctgatcccctcaggcagcagagagtataaagag
aagagagaacaatactctgactttaatcaagtgtttactttcatttttggtcttctaaat
gcaaacaggagaaagattcttgagacatcctttggataccagctaccgatggtagacagc
ttcaagtggtactcggtgggatacatgaaacatttggaccgtgacccggaaaagttgacg
caccatatgcctttgttttactgtctctatgagaatcgggaagaagaatttgtgaagacg
attgtggatgctctcatggaggttacagtttaccttcaatcagacaaggatatgatggtc
tcattatactgtctggattactgctgtcacctgaggacacttaagttgagtgttcagcgc
atctttcaaaacaaagagccacttataaggccaactgctagtcaaatgaagagccttgtc
tactggagagagatctgctctcttttttatacaatggagagcctccgggagctgcatatc
tttgacaatgaccttaatggtatttcagaaaggattctgtctaaagccctggagcattct
agctgtaaacttcgcacactcaagttgtcctatgtctcgactgcttctggttttgaagac
ttactcaaggctttggctcgtaatcggagcctgacatacctgagtatcaactgtacgtcc
atttccctaaatatgttttcacttctgcatgacatcctgcacgagcccacatgccaaata
agtcatctgagcttgatgaaatgtgatttgcgagccagcgaatgtgaagaaatcgcctct
ctcctcatcagtggcgggagtctgagaaaactgaccttatccagcaatccgctgaggagc
gacgggatgaacatactgtgtgatgccttgcttcatcccaactgcactcttatatcactg
gtgttagtcttctgctgtctcactgaaaattgctgcagcgcccttggaagagtgcttctg
ttcagcccaactctaagacaactagacctgtgtgtgaatcgcttaaaaaattacggagtg
ttgcatgtgacgtttcccttgctgtttccaacctgtcagttagaggagcttcatctgtct
ggctgtttctttagcagcgatatctgtcaatatattgccatagttattgctactaatgaa
aaactgaggagcctggagattgggagcaacaaaatagaagatgcaggaatgcagctgcta
tgtggtggtttgagacatcccaactgcatgttggtgaatattgggctagaagagtgcatg
ttaaccagtgcctgctgtcgatctcttgcctctgttcttaccaccaacaaaacactagaa
agactcaacttgcttcaaaatcacttgggcaatgatggagttgcaaaacttcttgagagc
ttgatcagcccagattgtgtacttaaggtagttgggcttccattaactggcctgaacaca
caaacccagcagttgctgatgactgtaaaggaaagaaaacccagtttgatctttctgtct
gaaacttggtctttaaaggaaggcagagaaattggtgtgacacctgcttctcagccaggt
tcaataatacctaattctaatttggattacatgtttttcaaatttcccagaatgtctgca
gccatgagaacgtcaaatacagcatctaggcaacccctttga

DBGET integrated database retrieval system