KEGG   Homo sapiens (human): 204851Help
Entry
204851            CDS       T01001                                 

Gene name
HIPK1, Myak, Nbak2
Definition
(RefSeq) homeodomain interacting protein kinase 1 (EC:2.7.11.1)
  KO
K08826  
homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     204851 (HIPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   204851 (HIPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.2
AA seq 1210 aa AA seqDB search
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSH
QVANFNIPAYDQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQK
CGLKRKSEEVDSNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQH
EILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSR
LSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVA
TALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRA
PEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTD
MLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNME
ICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATL
SLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQ
TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATIT
PQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMI
PEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS
LPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPS
PPVSVITIRSDTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSA
LRGNSGSVLEGPGRVVADGTGTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQ
SSGCCITPTGYRAQRGGTSAAQPLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQA
PYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSAAALGSTSSIAHLFSPQGSSR
HAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLS
PTKISQYSYL
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacagctgcaagtgttttcgcccccatcagtgtcgtcgagtgccttctgcagt
gcgaagaaactgaaaatagagccctctggctgggatgtttcaggacagagtagcaacgac
aaatattatacccacagcaaaaccctcccagccacacaagggcaagccaactcctctcac
caggtagcaaatttcaacatccctgcttacgaccagggcctcctcctcccagctcctgca
gtggagcatattgttgtaacagccgctgatagctcgggcagtgctgctacatcaaccttc
caaagcagccagaccctgactcacagaagcaacgtttctttgcttgagccatatcaaaaa
tgtggattgaaacgaaaaagtgaggaagttgacagcaacggtagtgtgcagatcatagaa
gaacatccccctctcatgctgcaaaacaggactgtggtgggtgctgctgccacaaccacc
actgtgaccacaaagagtagcagttccagcggagaaggggattaccagctggtccagcat
gagatcctttgctctatgaccaatagctatgaagtcttggagttcctaggccgggggaca
tttggacaggtggctaagtgctggaagaggagcaccaaggaaattgtggctattaaaatc
ttgaagaaccacccctcctatgccagacaaggacagattgaagtgagcatcctttcccgc
ctaagcagtgaaaatgctgatgagtataattttgtccgttcatacgagtgctttcagcat
aagaatcacacctgccttgtttttgaaatgttggagcagaacttatatgattttctaaag
caaaacaaatttagcccactgccactcaagtacatcagaccaatcttgcagcaggtggcc
acagccttgatgaagctcaagagtcttggtctgatccacgctgaccttaagcctgaaaac
atcatgctggttgatccagttcgccagccctaccgagtgaaggtcattgactttggttct
gctagtcacgtttccaaagctgtgtgctcaacctacttacagtcacgttactacagagct
cctgaaattattcttgggttaccattttgtgaagctattgatatgtggtcactgggctgt
gtgatagctgagctgttcctgggatggcctctttatcctggtgcttcagaatatgatcag
attcgttatatttcacaaacacaaggcttgccagctgaatatcttctcagtgccggaaca
aaaacaaccaggtttttcaacagagatcctaatttggggtacccactgtggaggcttaag
acacctgaagaacatgaactggagactggaataaaatcaaaagaagctcggaagtacatt
tttaattgcttagatgacatggctcaggtgaatatgtctacagacctggagggaacagac
atgttggcagagaaggcagaccgaagagaatacattgatctgttaaagaaaatgctcaca
attgatgcagataagagaattacccctctaaaaactcttaaccatcagtttgtgacaatg
actcaccttttggattttccacatagcaatcatgttaagtcttgttttcagaacatggag
atctgcaagcggagggttcacatgtatgatacagtgagtcagatcaagagtcccttcact
acacatgttgccccaaatacaagcacaaatctaaccatgagcttcagcaatcagctcaat
acagtgcacaatcaggccagtgttctagcttccagttctactgcagcagctgctactctt
tctctggctaattcagatgtctcactactaaactaccagtcagctttgtacccatcatct
gctgcaccagttcctggagttgcccagcagggtgtttccttgcagcctggaaccacccag
atttgcactcagacagatccattccaacagacatttatagtatgtccacctgcgtttcaa
actggactacaagcaacaacaaagcattctggattccctgtgaggatggataatgctgta
ccgattgtaccccaggcaccagctgctcagccactacagattcagtcaggagttctcacg
cagggaagctgtacaccactaatggtagcaactctccaccctcaagtagccaccatcaca
ccgcagtatgcggtgccctttactctgagctgcgcagccggccggccggcgctggttgaa
cagactgccgctgtactgcaggcgtggcctggagggactcagcaaattctcctgccttca
acttggcaacagttgcctggggtagctctacacaactctgtccagcccacagcaatgatt
ccagaggccatggggagtggacagcagctagctgactggaggaatgcccactctcatggc
aaccagtacagcactatcatgcagcagccatccttgctgactaaccatgtgacattggcc
actgctcagcctctgaatgttggtgttgcccatgttgtcagacaacaacaatccagttcc
ctcccttcgaagaagaataagcagtcagctccagtctcttccaagtcctctctagatgtt
ctgccttcccaagtctattctctggttgggagcagtcccctccgcaccacatcttcttat
aattccttggtccctgtccaagatcagcatcagcccatcatcattccagatactcccagc
cctcctgtgagtgtcatcactatccgaagtgacactgatgaggaagaggacaacaaatac
aagcccagtagctctggactgaagccaaggtctaatgtcatcagttatgtcactgtcaat
gattctccagactctgactcttctttgagcagcccttattccactgataccctgagtgct
ctccgaggcaatagtggatccgttttggaggggcctggcagagttgtggcagatggcact
ggcacccgcactatcattgtgcctccactgaaaactcagcttggtgactgcactgtagca
acccaggcctcaggtctcctgagcaataagactaagccagtcgcttcagtgagtgggcag
tcatctggatgctgtatcacccccacagggtatcgagctcaacgcggggggaccagtgca
gcacaaccactcaatcttagccagaaccagcagtcatcggcggctccaacctcacaggag
agaagcagcaacccagccccccgcaggcagcaggcgtttgtggcccctctctcccaagcc
ccctacaccttccagcatggcagcccgctacactcgacagggcacccacaccttgccccg
gcccctgctcacctgccaagccaggctcatctgtatacgtatgctgccccgacttctgct
gctgcactgggctcaaccagctccattgctcatcttttctccccacagggttcctcaagg
catgctgcagcctataccactcaccctagcactttggtgcaccaggtccctgtcagtgtt
gggcccagcctcctcacttctgccagcgtggcccctgctcagtaccaacaccagtttgcc
acccaatcctacattgggtcttcccgaggctcaacaatttacactggatacccgctgagt
cctaccaagatcagccagtattcctacttatag

DBGET integrated database retrieval system