KEGG   Homo sapiens (human): 2049Help
Entry
2049              CDS       T01001                                 

Gene name
EPHB3, EK2, ETK2, HEK2, TYRO6
Definition
(RefSeq) EPH receptor B3 (EC:2.7.10.1)
  KO
K05112  
Eph receptor B3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2049 (EPHB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2049 (EPHB3)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Eph family
   2049 (EPHB3)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   2049 (EPHB3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   2049 (EPHB3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EFNB; ephrin-B [KO:K05463]
   2049 (EPHB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.1
AA seq 998 aa AA seqDB search
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcccgcccgccgccgccgccgtcgccgccgccggggcttctgccgctgctc
cctccgctgctgctgctgccgctgctgctgctgcccgccggctgccgggcgctggaagag
accctcatggacacaaaatgggtaacatctgagttggcgtggacatctcatccagaaagt
gggtgggaagaggtgagtggctacgatgaggccatgaatcccatccgcacataccaggtg
tgtaatgtgcgcgagtcaagccagaacaactggcttcgcacggggttcatctggcggcgg
gatgtgcagcgggtctacgtggagctcaagttcactgtgcgtgactgcaacagcatcccc
aacatccccggctcctgcaaggagaccttcaacctcttctactacgaggctgacagcgat
gtggcctcagcctcctcccccttctggatggagaacccctacgtgaaagtggacaccatt
gcacccgatgagagcttctcgcggctggatgccggccgtgtcaacaccaaggtgcgcagc
tttgggccactttccaaggctggcttctacctggccttccaggaccagggcgcctgcatg
tcgctcatctccgtgcgcgccttctacaagaagtgtgcatccaccaccgcaggcttcgca
ctcttccccgagaccctcactggggcggagcccacctcgctggtcattgctcctggcacc
tgcatccctaacgccgtggaggtgtcggtgccactcaagctctactgcaacggcgatggg
gagtggatggtgcctgtgggtgcctgcacctgtgccaccggccatgagccagctgccaag
gagtcccagtgccgcccctgtccccctgggagctacaaggcgaagcagggagaggggccc
tgcctcccatgtccccccaacagccgtaccacctccccagccgccagcatctgcacctgc
cacaataacttctaccgtgcagactcggactctgcggacagtgcctgtaccaccgtgcca
tctccaccccgaggtgtgatctccaatgtgaatgaaacctcactgatcctcgagtggagt
gagccccgggacctgggtggccgggatgacctcctgtacaatgtcatctgcaagaagtgc
catggggctggaggggcctcagcctgctcacgctgtgatgacaacgtggagtttgtgcct
cggcagctgggcctgacggagcgccgggtccacatcagccatctgctggcccacacgcgc
tacacctttgaggtgcaggcggtcaacggtgtctcgggcaagagccctctgccgcctcgt
tatgcggccgtgaatatcaccacaaaccaggctgccccgtctgaagtgcccacactacgc
ctgcacagcagctcaggcagcagcctcaccctatcctgggcacccccagagcggcccaac
ggagtcatcctggactacgagatgaagtactttgagaagagcgagggcatcgcctccaca
gtgaccagccagatgaactccgtgcagctggacgggcttcggcctgacgcccgctatgtg
gtccaggtccgtgcccgcacagtagctggctatgggcagtacagccgccctgccgagttt
gagaccacaagtgagagaggctctggggcccagcagctccaggagcagcttcccctcatc
gtgggctccgctacagctgggcttgtcttcgtggtggctgtcgtggtcatcgctatcgtc
tgcctcaggaagcagcgacacggctctgattcggagtacacggagaagctgcagcagtac
attgctcctggaatgaaggtttatattgacccttttacctacgaggaccctaatgaggct
gttcgggagtttgccaaggagatcgacgtgtcctgcgtcaagatcgaggaggtgatcgga
gctggggaatttggggaagtgtgccgtggtcgactgaaacagcctggccgccgagaggtg
tttgtggccatcaagacgctgaaggtgggctacaccgagaggcagcggcgggacttccta
agcgaggcctccatcatgggtcagtttgatcaccccaatataatccggctcgagggcgtg
gtcaccaaaagtcggccagttatgatcctcactgagttcatggaaaactgcgccctggac
tccttcctccggctcaacgatgggcagttcacggtcatccagctggtgggcatgttgcgg
ggcattgctgccggcatgaagtacctgtccgagatgaactatgtgcaccgcgacctggct
gctcgcaacatccttgtcaacagcaacctggtctgcaaagtctcagactttggcctctcc
cgcttcctggaggatgacccctccgatcctacctacaccagttccctgggcgggaagatc
cccatccgctggactgccccagaggccatagcctatcggaagttcacttctgctagtgat
gtctggagctacggaattgtcatgtgggaggtcatgagctatggagagcgaccctactgg
gacatgagcaaccaggatgtcatcaatgccgtggagcaggattaccggctgccaccaccc
atggactgtcccacagcactgcaccagctcatgctggactgctgggtgcgggaccggaac
ctcaggcccaaattctcccagattgtcaataccctggacaagctcatccgcaatgctgcc
agcctcaaggtcattgccagcgctcagtctggcatgtcacagcccctcctggaccgcacg
gtcccagattacacaaccttcacgacagttggtgattggctggatgccatcaagatgggg
cggtacaaggagagcttcgtcagtgcggggtttgcatcttttgacctggtggcccagatg
acggcagaagacctgctccgtattggggtcaccctggccggccaccagaagaagatcctg
agcagtatccaggacatgcggctgcagatgaaccagacgctgcctgtgcaggtctga

DBGET integrated database retrieval system