KEGG   Homo sapiens (human): 204962Help
Entry
204962            CDS       T01001                                 

Gene name
SLC44A5, CTL5
Definition
(RefSeq) solute carrier family 44 member 5
  KO
K15377  
solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
hsa  Homo sapiens (human)
Pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    204962 (SLC44A5)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC44: Choline-like transporter
   204962 (SLC44A5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   204962 (SLC44A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NCS7(Tdark)
UniProt: 
Position
1p31.1
AA seq 719 aa AA seqDB search
MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAW
VHGDPRRAAYPTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSK
CPEKFLTYVEMQLLYTKDKSYWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQ
RCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYAR
TWYWILIGLTIAMVLSWIFLILLRFIAGCLFWVFMIGVIGIIGYGIWHCYQQYTNLQERP
SSVLTIYDIGIQTNISMYFELQQTWFTFMIILCIIEVIVILMLIFLRNRIRVAIILLKEG
SKAIGYVPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPGGHCIHENQTCD
PEIFNTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALA
GAFATYYWAMKKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLDHRL
KRTQNTLSKFLQCCLRCCFWCLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVL
KVAVTDEVTYFVLFLGKLLVAGSIGVLAFLFFTQRLPVIAQGPASLNYYWVPLLTVIFGS
YLIAHGFFSVYAMCVETIFICFCEDLERNDGSTEKPYFVTPNLHGILIKKQLVPQKQKE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacacagaaaaaccagcagatactccctctgaggaagaggactttggtgatcca
aggacatatgacccagatttcaaggggcctgttgccaacaggagttgtacagatgttctg
tgctgtatgatcttcctactgtgtattattggctacattgttttaggacttgtggcctgg
gtacatggggaccccagaagagcagcctatcctacagacagccagggccacttttgtggc
cagaagggcactcccaatgagaacaagaccattttgttttactttaacctgttacgctgt
accagtccctccgtgttgctaaacctacagtgccctaccacacagatctgtgtctccaag
tgcccagaaaaatttttaacctatgtggaaatgcaacttttgtacacaaaagacaaaagc
tactgggaagactaccgtcagttctgtaagaccactgctaagcctgtgaagtctctcaca
cagcttttactggatgatgattgtccaacagcgatttttcccagcaaaccttttctccag
agatgtttccctgacttctctaccaaaaatggcactttaacaataggaagtaagatgatg
tttcaagatggaaatggagggacaagaagtgttgtagaactcgggattgctgcaaatggt
atcaataaacttcttgatgcaaagtcacttggattgaaagtgtttgaagactatgcaaga
acttggtattggattctcattggcctgacgattgccatggtccttagttggatatttttg
atacttctgaggttcatagctggatgcctcttctgggtcttcatgattggtgtgattgga
attataggttatggaatatggcactgttaccagcagtacaccaatcttcaggaacgccca
agttctgtattaactatctatgacatcgggattcagactaacataagcatgtactttgaa
ctgcaacaaacatggttcacatttatgataatactctgcatcattgaagtgattgtcatc
ctcatgctgatcttcctcaggaatcgaatccgagtcgccattatcctgctgaaggaagga
agcaaagccattggatatgttcctagtacattagtctatccagctttaactttcattttg
ctctcaatctgcatttgctactgggtcgtgacagcagttttcttggcgacatcgggggta
cctgtatacaaagtcatagctccaggggggcattgtatacatgaaaatcaaacctgtgac
ccagagatttttaatacaactgaaattgccaaagcttgccctggggctctgtgtaacttt
gctttctatggtggaaagagcttgtaccatcagtacatccctaccttccatgtatacaac
ttatttgtctttctctggcttataaacttcgtcattgcattaggtcagtgcgcccttgct
ggtgcattcgctacttattactgggccatgaaaaaacctgatgacatcccacgatatcca
ctttttactgcatttggacgagccatacgatatcacacaggatccctagcatttggatct
ttaattattgcattaattcaaatgtttaaaattgtactagaatacttggaccaccgtctt
aaacgtacccagaacacattgtctaaattcctacaatgctgcctgagatgctgcttctgg
tgtttggaaaatgcaataaagtttttaaacagaaatgcctatattatgattgcaatatat
ggcagaaacttctgcaggtcagcaaaagatgctttcaatctgctgatgagaaatgttttg
aaagttgcagttacagatgaagttacatactttgtattattcctggggaaacttctagtt
gctggaagtataggtgttctggccttcctattcttcacacaaagactgccagtgattgca
caaggaccagcatctttaaattactactgggtacctttgctgacagtcatttttgggtct
tacctgattgcacatgggttcttcagcgtctatgcaatgtgtgttgaaacaattttcatc
tgcttctgtgaagatctggaaagaaatgatggatctacagaaaaaccctacttcgtaacc
cctaacctgcatggaattctgatcaagaagcaactagttccccagaagcagaaagagtag

DBGET integrated database retrieval system