KEGG   Homo sapiens (human): 2050Help
Entry
2050              CDS       T01001                                 

Gene name
EPHB4, HTK, MYK1, TYRO11
Definition
EPH receptor B4 (EC:2.7.10.1)
Orthology
K05113  
Eph receptor B4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22
AA seq 987 aa AA seqDB search
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggtgctgctctgctgggcttcgttggccgcagctttggaagagaccctg
ctgaacacaaaattggaaactgctgatctgaagtgggtgacattccctcaggtggacggg
cagtgggaggaactgagcggcctggatgaggaacagcacagcgtgcgcacctacgaagtg
tgtgacgtgcagcgtgccccgggccaggcccactggcttcgcacaggttgggtcccacgg
cggggcgccgtccacgtgtacgccacgctgcgcttcaccatgctcgagtgcctgtccctg
cctcgggctgggcgctcctgcaaggagaccttcaccgtcttctactatgagagcgatgcg
gacacggccacggccctcacgccagcctggatggagaacccctacatcaaggtggacacg
gtggccgcggagcatctcacccggaagcgccctggggccgaggccaccgggaaggtgaat
gtcaagacgctgcgtctgggaccgctcagcaaggctggcttctacctggccttccaggac
cagggtgcctgcatggccctgctatccctgcacctcttctacaaaaagtgcgcccagctg
actgtgaacctgactcgattcccggagactgtgcctcgggagctggttgtgcccgtggcc
ggtagctgcgtggtggatgccgtccccgcccctggccccagccccagcctctactgccgt
gaggatggccagtgggccgaacagccggtcacgggctgcagctgtgctccggggttcgag
gcagctgaggggaacaccaagtgccgagcctgtgcccagggcaccttcaagcccctgtca
ggagaagggtcctgccagccatgcccagccaatagccactctaacaccattggatcagcc
gtctgccagtgccgcgtcgggtacttccgggcacgcacagacccccggggtgcaccctgc
accacccctccttcggctccgcggagcgtggtttcccgcctgaacggctcctccctgcac
ctggaatggagtgcccccctggagtctggtggccgagaggacctcacctacgccctccgc
tgccgggagtgccgacccggaggctcctgtgcgccctgcgggggagacctgacttttgac
cccggcccccgggacctggtggagccctgggtggtggttcgagggctacgtcctgacttc
acctatacctttgaggtcactgcattgaacggggtatcctccttagccacggggcccgtc
ccatttgagcctgtcaatgtcaccactgaccgagaggtacctcctgcagtgtctgacatc
cgggtgacgcggtcctcacccagcagcttgagcctggcctgggctgttccccgggcaccc
agtggggctgtgctggactacgaggtcaaataccatgagaagggcgccgagggtcccagc
agcgtgcggttcctgaagacgtcagaaaaccgggcagagctgcgggggctgaagcgggga
gccagctacctggtgcaggtacgggcgcgctctgaggccggctacgggcccttcggccag
gaacatcacagccagacccaactggatgagagcgagggctggcgggagcagctggccctg
attgcgggcacggcagtcgtgggtgtggtcctggtcctggtggtcattgtggtcgcagtt
ctctgcctcaggaagcagagcaatgggagagaagcagaatattcggacaaacacggacag
tatctcatcggacatggtactaaggtctacatcgaccccttcacttatgaagaccctaat
gaggctgtgagggaatttgcaaaagagatcgatgtctcctacgtcaagattgaagaggtg
attggtgcaggtgagtttggcgaggtgtgccgggggcggctcaaggccccagggaagaag
gagagctgtgtggcaatcaagaccctgaagggtggctacacggagcggcagcggcgtgag
tttctgagcgaggcctccatcatgggccagttcgagcaccccaatatcatccgcctggag
ggcgtggtcaccaacagcatgcccgtcatgattctcacagagttcatggagaacggcgcc
ctggactccttcctgcggctaaacgacggacagttcacagtcatccagctcgtgggcatg
ctgcggggcatcgcctcgggcatgcggtaccttgccgagatgagctacgtccaccgagac
ctggctgctcgcaacatcctagtcaacagcaacctcgtctgcaaagtgtctgactttggc
ctttcccgattcctggaggagaactcttccgatcccacctacacgagctccctgggagga
aagattcccatccgatggactgccccggaggccattgccttccggaagttcacttccgcc
agtgatgcctggagttacgggattgtgatgtgggaggtgatgtcatttggggagaggccg
tactgggacatgagcaatcaggacgtgatcaatgccattgaacaggactaccggctgccc
ccgcccccagactgtcccacctccctccaccagctcatgctggactgttggcagaaagac
cggaatgcccggccccgcttcccccaggtggtcagcgccctggacaagatgatccggaac
cccgccagcctcaaaatcgtggcccgggagaatggcggggcctcacaccctctcctggac
cagcggcagcctcactactcagcttttggctctgtgggcgagtggcttcgggccatcaaa
atgggaagatacgaagaaagtttcgcagccgctggctttggctccttcgagctggtcagc
cagatctctgctgaggacctgctccgaatcggagtcactctggcgggacaccagaagaaa
atcttggccagtgtccagcacatgaagtcccaggccaagccgggaaccccgggtgggaca
ggaggaccggccccgcagtactga

DBGET integrated database retrieval system