KEGG   Homo sapiens (human): 2050Help
Entry
2050              CDS       T01001                                 

Gene name
EPHB4, HFASD, HTK, MYK1, TYRO11
Definition
(RefSeq) EPH receptor B4
  KO
K05113  Eph receptor B4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2050 (EPHB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2050 (EPHB4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases
  EPH family [OT]
   2050 (EPHB4)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   2050 (EPHB4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EFNB; ephrin-B [KO:K05463]
   2050 (EPHB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2050
NCBI-ProteinID: NP_004435
OMIM: 600011
HGNC: 3395
Ensembl: ENSG00000196411
Vega: OTTHUMG00000157040
Pharos: P54760(Tchem)
UniProt: P54760 Q541P7 Q96L35
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 987 aa AA seqDB search
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggtgctgctctgctgggcttcgttggccgcagctttggaagagaccctg
ctgaacacaaaattggaaactgctgatctgaagtgggtgacattccctcaggtggacggg
cagtgggaggaactgagcggcctggatgaggaacagcacagcgtgcgcacctacgaagtg
tgtgacgtgcagcgtgccccgggccaggcccactggcttcgcacaggttgggtcccacgg
cggggcgccgtccacgtgtacgccacgctgcgcttcaccatgctcgagtgcctgtccctg
cctcgggctgggcgctcctgcaaggagaccttcaccgtcttctactatgagagcgatgcg
gacacggccacggccctcacgccagcctggatggagaacccctacatcaaggtggacacg
gtggccgcggagcatctcacccggaagcgccctggggccgaggccaccgggaaggtgaat
gtcaagacgctgcgtctgggaccgctcagcaaggctggcttctacctggccttccaggac
cagggtgcctgcatggccctgctatccctgcacctcttctacaaaaagtgcgcccagctg
actgtgaacctgactcgattcccggagactgtgcctcgggagctggttgtgcccgtggcc
ggtagctgcgtggtggatgccgtccccgcccctggccccagccccagcctctactgccgt
gaggatggccagtgggccgaacagccggtcacgggctgcagctgtgctccggggttcgag
gcagctgaggggaacaccaagtgccgagcctgtgcccagggcaccttcaagcccctgtca
ggagaagggtcctgccagccatgcccagccaatagccactctaacaccattggatcagcc
gtctgccagtgccgcgtcgggtacttccgggcacgcacagacccccggggtgcaccctgc
accacccctccttcggctccgcggagcgtggtttcccgcctgaacggctcctccctgcac
ctggaatggagtgcccccctggagtctggtggccgagaggacctcacctacgccctccgc
tgccgggagtgccgacccggaggctcctgtgcgccctgcgggggagacctgacttttgac
cccggcccccgggacctggtggagccctgggtggtggttcgagggctacgtcctgacttc
acctatacctttgaggtcactgcattgaacggggtatcctccttagccacggggcccgtc
ccatttgagcctgtcaatgtcaccactgaccgagaggtacctcctgcagtgtctgacatc
cgggtgacgcggtcctcacccagcagcttgagcctggcctgggctgttccccgggcaccc
agtggggctgtgctggactacgaggtcaaataccatgagaagggcgccgagggtcccagc
agcgtgcggttcctgaagacgtcagaaaaccgggcagagctgcgggggctgaagcgggga
gccagctacctggtgcaggtacgggcgcgctctgaggccggctacgggcccttcggccag
gaacatcacagccagacccaactggatgagagcgagggctggcgggagcagctggccctg
attgcgggcacggcagtcgtgggtgtggtcctggtcctggtggtcattgtggtcgcagtt
ctctgcctcaggaagcagagcaatgggagagaagcagaatattcggacaaacacggacag
tatctcatcggacatggtactaaggtctacatcgaccccttcacttatgaagaccctaat
gaggctgtgagggaatttgcaaaagagatcgatgtctcctacgtcaagattgaagaggtg
attggtgcaggtgagtttggcgaggtgtgccgggggcggctcaaggccccagggaagaag
gagagctgtgtggcaatcaagaccctgaagggtggctacacggagcggcagcggcgtgag
tttctgagcgaggcctccatcatgggccagttcgagcaccccaatatcatccgcctggag
ggcgtggtcaccaacagcatgcccgtcatgattctcacagagttcatggagaacggcgcc
ctggactccttcctgcggctaaacgacggacagttcacagtcatccagctcgtgggcatg
ctgcggggcatcgcctcgggcatgcggtaccttgccgagatgagctacgtccaccgagac
ctggctgctcgcaacatcctagtcaacagcaacctcgtctgcaaagtgtctgactttggc
ctttcccgattcctggaggagaactcttccgatcccacctacacgagctccctgggagga
aagattcccatccgatggactgccccggaggccattgccttccggaagttcacttccgcc
agtgatgcctggagttacgggattgtgatgtgggaggtgatgtcatttggggagaggccg
tactgggacatgagcaatcaggacgtgatcaatgccattgaacaggactaccggctgccc
ccgcccccagactgtcccacctccctccaccagctcatgctggactgttggcagaaagac
cggaatgcccggccccgcttcccccaggtggtcagcgccctggacaagatgatccggaac
cccgccagcctcaaaatcgtggcccgggagaatggcggggcctcacaccctctcctggac
cagcggcagcctcactactcagcttttggctctgtgggcgagtggcttcgggccatcaaa
atgggaagatacgaagaaagtttcgcagccgctggctttggctccttcgagctggtcagc
cagatctctgctgaggacctgctccgaatcggagtcactctggcgggacaccagaagaaa
atcttggccagtgtccagcacatgaagtcccaggccaagccgggaaccccgggtgggaca
ggaggaccggccccgcagtactga

DBGET integrated database retrieval system