KEGG   Homo sapiens (human): 2052Help
Entry
2052              CDS       T01001                                 

Gene name
EPHX1, EPHX, EPOX, HYL1, MEH
Definition
epoxide hydrolase 1, microsomal (xenobiotic) (EC:3.3.2.9)
Orthology
K01253  
microsomal epoxide hydrolase [EC:3.3.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Bile secretion
Chemical carcinogenesis
Disease
H00516  
Isolated orofacial clefts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2052 (EPHX1)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    2052 (EPHX1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    2052 (EPHX1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.9  microsomal epoxide hydrolase
     2052 (EPHX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.1
AA seq 455 aa AA seqDB search
MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEI
HDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKI
EGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEV
ICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVP
SHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVML
YWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtggctagaaatcctcctcacttcagtgctgggctttgccatctactggttcatctcc
cgggacaaagaggaaactttgccacttgaagatgggtggtgggggccaggcacgaggtcc
gcagccagggaggacgacagcatccgccctttcaaggtggaaacgtcagatgaggagatc
cacgacttacaccagaggatcgataagttccgtttcaccccacctttggaggacagctgc
ttccactatggcttcaactccaactacctgaagaaagtcatctcctactggcggaatgaa
tttgactggaagaagcaggtggagattctcaacagataccctcacttcaagactaagatt
gaagggctggacatccacttcatccacgtgaagcccccccagctgcccgcaggccatacc
ccgaagcccttgctgatggtgcacggctggcccggctctttctacgagttttataagatc
atcccactcctgactgaccccaagaaccatggcctgagcgatgagcacgtttttgaagtc
atctgcccttccatccctggctatggcttctcagaggcatcctccaagaaggggttcaac
tcggtggccaccgccaggatcttttacaagctgatgctgcggctgggcttccaggaattc
tacattcaaggaggggactgggggtccctgatctgcactaatatggcccagctggtgccc
agccacgtgaaaggcctgcacttgaacatggctttggttttaagcaacttctctaccctg
accctcctcctgggacagcgtttcgggaggtttcttggcctcactgagagggatgtggag
ctgctgtaccccgtcaaggagaaggtattctacagcctgatgagggagagcggctacatg
cacatccagtgcaccaagcctgacaccgtaggctctgctctgaatgactctcctgtgggt
ctggctgcctatattctagagaagttttccacctggaccaatacggaattccgatacctg
gaggatggaggcctggaaaggaagttctccctggacgacctgctgaccaacgtcatgctc
tactggacaacaggcaccatcatctcctcccagcgcttctacaaggagaacctgggacag
ggctggatgacccagaagcatgagcggatgaaggtctatgtgcccactggcttctctgcc
ttcccttttgagctattgcacacgcctgaaaagtgggtgaggttcaagtacccaaagctc
atctcctattcctacatggttcgtgggggccactttgcggcctttgaggagccggagctg
ctcgcccaggacatccgcaagttcctgtcggtgctggagcggcaatga

DBGET integrated database retrieval system