KEGG   Homo sapiens (human): 2054Help
Entry
2054              CDS       T01001                                 

Gene name
STX2, EPIM, EPM, STX2A, STX2B, STX2C
Definition
syntaxin 2
Orthology
K08486  
syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.33
AA seq 288 aa AA seqDB search
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSII
LSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS
VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDI
ISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT
DYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccggctgccagacctgacggcgtgtaggaagaatgatgatggagacacagtt
gttgtggttgagaaagatcatttcatggatgatttcttccatcaggtggaggagattaga
aacagtattgataaaataactcaatatgttgaagaagtaaagaaaaaccacagcatcatt
ctttctgcaccaaacccggaaggaaaaataaaagaagagcttgaagatctgaacaaagaa
atcaagaaaactgcgaataaaattcgagccaagttaaaggctattgaacaaagttttgat
caggatgagagtgggaaccggacttcagtggatcttcggatacgaagaacccagcattcg
gtgctgtctcggaagtttgtggaagccatggcggagtacaatgaggcacagactctgttt
cgggagcggagcaaaggccgcatccagcgccagctggagataactgggagaaccaccaca
gacgacgagctagaagagatgctggagagcgggaagccatccatcttcacttccgacatt
atatcagattcacaaattactagacaagctctcaatgaaatcgagtcacgtcacaaggac
atcatgaagctggagaccagcatccgagagttgcatgagatgttcatggacatggctatg
tttgtggagactcagggtgaaatgatcaacaacatagaaagaaatgttatgaatgccaca
gactatgtagaacacgctaaagaagaaacaaaaaaagctatcaaatatcagagcaaggca
agaaggaaaaagtggataattattgctgtgtcagtggttctggttgccataatcgctcta
attattggcttgtcagttggcaaatga

DBGET integrated database retrieval system