KEGG   Homo sapiens (human): 2054Help
Entry
2054              CDS       T01001                                 

Gene name
STX2, EPIM, EPM, STX2A, STX2B, STX2C
Definition
syntaxin 2
Orthology
K08486  
syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    2054 (STX2)
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    2054 (STX2)
SNAREs [BR:hsa04131]
 Syntaxin (Qa)
  Stx-PM
   2054 (STX2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   2054 (STX2)
  Exosomal proteins of other body fluids (saliva and urine)
   2054 (STX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.33
AA seq 288 aa AA seqDB search
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSII
LSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS
VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDI
ISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT
DYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccggctgccagacctgacggcgtgtaggaagaatgatgatggagacacagtt
gttgtggttgagaaagatcatttcatggatgatttcttccatcaggtggaggagattaga
aacagtattgataaaataactcaatatgttgaagaagtaaagaaaaaccacagcatcatt
ctttctgcaccaaacccggaaggaaaaataaaagaagagcttgaagatctgaacaaagaa
atcaagaaaactgcgaataaaattcgagccaagttaaaggctattgaacaaagttttgat
caggatgagagtgggaaccggacttcagtggatcttcggatacgaagaacccagcattcg
gtgctgtctcggaagtttgtggaagccatggcggagtacaatgaggcacagactctgttt
cgggagcggagcaaaggccgcatccagcgccagctggagataactgggagaaccaccaca
gacgacgagctagaagagatgctggagagcgggaagccatccatcttcacttccgacatt
atatcagattcacaaattactagacaagctctcaatgaaatcgagtcacgtcacaaggac
atcatgaagctggagaccagcatccgagagttgcatgagatgttcatggacatggctatg
tttgtggagactcagggtgaaatgatcaacaacatagaaagaaatgttatgaatgccaca
gactatgtagaacacgctaaagaagaaacaaaaaaagctatcaaatatcagagcaaggca
agaaggaaaaagtggataattattgctgtgtcagtggttctggttgccataatcgctcta
attattggcttgtcagttggcaaatga

DBGET integrated database retrieval system