KEGG   Homo sapiens (human): 205428Help
Entry
205428            CDS       T01001                                 

Gene name
C3orf58, DIA1, GoPro49, HASF
Definition
chromosome 3 open reading frame 58
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 221 aa AA seqDB search
MKSENGTVVGSFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLME
IAEQLTNNDFEFALYLLDVSFDNFAVGPRDGKVIIVDAENVLVADKRLIRQNKPENWDVW
YESKFDDCDKEACLSFSKEILCARATVDHNYYAVCQNLLSRHATWRGTSGGLLHDPPSEI
AKDGRLEALLDECANPKKRYGRFQAAKELREYLAQLSNNVR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggagaacgggacagtggtcgggagttttccgtctgatgaaggttggccattt
gcaaagtatcttggagcttgtggaagaatggtggctgtaaattatgttggagaagaactg
tggagttactttaatgcgccatgggaaaaacgagttgacctcgcttggcaattaatggaa
atagcagaacagcttacaaacaatgactttgaatttgcactctacctcctggacgtcagc
tttgacaattttgcagttggtcctagagatgggaaggtaatcattgtggatgctgaaaat
gttttggttgctgacaaaagattaattagacaaaataaacctgaaaattgggatgtatgg
tatgaaagcaagtttgatgactgtgataaggaggcttgcttatcattttcaaaagaaatt
ctttgtgctcgtgccactgtggaccacaattactatgctgtttgtcagaacctcttatcc
agacatgccacctggcgtggcacttctggaggactccttcatgatccaccaagtgaaatt
gccaaagatggccggctcgaggccttgctggatgagtgtgccaacccaaagaagcgctat
ggcagattccaggctgcaaaagaactgcgtgaatacctagcacaattaagtaacaacgtg
aggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system