KEGG   Homo sapiens (human): 2057Help
Entry
2057              CDS       T01001                                 

Gene name
EPOR, EPO-R
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00236  Congenital polycythemia
Drug target
Darbepoetin alfa: D03651
Erythropoietin (DG00177): D03231 D03232 D04032 D10000 D10846 D10847
Methoxy polyethylene glycol-epoetin beta: D09998
Peginesatide (DG00178): D09946 D09947
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2057 (EPOR)
   04151 PI3K-Akt signaling pathway
    2057 (EPOR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2057 (EPOR)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2057 (EPOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2057 (EPOR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   2057 (EPOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3
Motif
Other DBs
NCBI-GeneID: 2057
NCBI-ProteinID: NP_000112
OMIM: 133171
HGNC: 3416
Ensembl: ENSG00000187266
Vega: OTTHUMG00000182027
Pharos: P19235(Tclin)
UniProt: P19235
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 508 aa AA seqDB search
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaccacctcggggcgtccctctggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcctaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgggggcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagcgctggggtgggcccgggcaactacagcttctcc
taccagctcgaggatgagccatggaagctgtgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtgtcatccacatcaat
gaagtagtgctcctagacgcccccgtggggctggtggcgcggttggctgacgagagcggc
cacgtagtgttgcgctggctcccgccgcctgagacacccatgacgtctcacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtacagagggtggagatcctggag
ggccgcaccgagtgtgtgctgagcaacctgcggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
gtcatcctggtgctgctgaccgtgctcgcgctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaatgatggctgcctgtggtggagcccctgc
acccccttcacggaggacccacctgcttccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccagtgggc
agtgagcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctggtggcagtgtggacatagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcccagcccagagggagcctct
gctgccagctttgagtacactatcctggaccccagctcccagctcttgcgtccatggaca
ctgtgccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtggtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tccgatggcccctactccaacccttatgagaacagccttatcccagccgctgagcctctg
ccccccagctatgtggcttgctcttag

DBGET integrated database retrieval system