KEGG   Homo sapiens (human): 2069Help
Entry
2069              CDS       T01001                                 

Gene name
EREG, EPR, ER, Ep
Definition
(RefSeq) epiregulin
  KO
K09784  
epiregulin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
PI3K-Akt signaling pathway
Colorectal cancer
Network
N00277  
EREG-EGFR-RAS-ERK signaling pathway
N00278  
EREG-overexpression to RAS-ERK signaling pathway
N00282  
EREG-EGFR-PI3K signaling pathway
N00283  
EREG-overexpression to PI3K signaling pathway
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2069 (EREG)
   04012 ErbB signaling pathway
    2069 (EREG)
   04151 PI3K-Akt signaling pathway
    2069 (EREG)
 Human Diseases
  Cancers
   05210 Colorectal cancer
    2069 (EREG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14944(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
4q13.3
AA seq 169 aa AA seqDB search
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggggaggaggatggagatgctctgtgccggcagggtccctgcgctgctgctc
tgcctgggtttccatcttctacaggcagtcctcagtacaactgtgattccatcatgtatc
ccaggagagtccagtgataactgcacagctttagttcagacagaagacaatccacgtgtg
gctcaagtgtcaataacaaagtgtagctctgacatgaatggctattgtttgcatggacag
tgcatctatctggtggacatgagtcaaaactactgcaggtgtgaagtgggttatactggt
gtccgatgtgaacacttctttttaaccgtccaccaacctttaagcaaagaatatgtggct
ttgaccgtgattcttattattttgtttcttatcacagtcgtcggttccacatattatttc
tgcagatggtacagaaatcgaaaaagtaaagaaccaaagaaggaatatgagagagttacc
tcaggggatccagagttgccgcaagtctga

DBGET integrated database retrieval system