KEGG   Homo sapiens (human): 2072Help
Entry
2072              CDS       T01001                                 

Gene name
ERCC4, ERCC11, FANCQ, RAD1, XFEPS, XPF
Definition
(RefSeq) ERCC excision repair 4, endonuclease catalytic subunit
  KO
K10848  
DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Fanconi anemia pathway
Disease
H00403  
Disorders of nucleotide excision repair
H01428  
Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    2072 (ERCC4)
   03460 Fanconi anemia pathway
    2072 (ERCC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     2072 (ERCC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    2072 (ERCC4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     2072 (ERCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92889(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.12
AA seq 916 aa AA seqDB search
MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVL
VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLT
DRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER
VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKEL
KCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ
YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEK
MEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL
RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
KERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSS
DAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG
KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGT
ASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTP
EMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEIS
SNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE
SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF
IHTSFAEVVSKGKGKK
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagggcagccggctcgacggattgccatggcgccgctgctggagtacgagcga
cagctggtgctggaactgctcgacactgacgggctagtagtgtgcgcccgcgggctcggc
gcggaccggctcctctaccactttctccagctgcactgccacccagcctgcctggtgctg
gtgctcaacacgcagccggccgaggaggagtattttatcaatcagctgaagatagaagga
gttgaacacctccctcgccgtgtaacaaatgaaatcacaagcaacagtcgctatgaagtt
tacacacaaggtggtgttatatttgcgacaagtaggatacttgtggttgacttcttgact
gatagaataccttcagatttaattactggcatcttggtgtatagagcccacagaataatc
gagtcttgtcaagaagcattcatcttgcgcctctttcgccagaaaaacaaacgtggtttt
attaaagctttcacagacaatgctgttgcctttgatactggtttttgtcatgtggaaaga
gtgatgagaaatctttttgtgaggaaactgtatctgtggccaaggttccatgtagcagta
aactcatttttagaacagcacaaacctgaagttgtagaaatccatgtttctatgacacct
accatgcttgctatacagactgctatactggacattttaaatgcatgtctaaaggaacta
aaatgccataacccatcgcttgaagtggaagatttatctttagaaaatgctattggaaaa
ccttttgacaagacaatccgccattatctggatcctttgtggcaccagcttggagccaag
actaaatccttagttcaggatttgaagatattacgaactttgctgcagtatctctctcag
tatgattgtgtcacatttcttaatcttctggaatctctgagagcaacggaaaaagctttt
ggtcagaattcaggttggctgtttcttgactccagcacctcgatgtttataaatgctcga
gcaagggtttatcatcttccagatgccaaaatgagtaaaaaagaaaaaatatctgaaaaa
atggaaattaaagaaggggaagaaacaaaaaaggaactggtcctagaaagcaacccaaag
tgggaggcactgactgaagtattaaaagaaattgaggcagaaaataaggagagtgaagct
cttggtggtccaggtcaagtactgatttgtgcaagtgatgaccgaacatgttcccagctg
agagactatatcactcttggagcggaggccttcttattgaggctctacaggaaaaccttt
gagaaggatagcaaagctgaagaagtctggatgaaatttaggaaggaagacagttcaaag
agaattaggaaatctcacaaaagacctaaagacccccaaaacaaagaacgggcttctacc
aaagaaagaaccctcaaaaagaaaaaacggaagttgaccttaactcaaatggtaggaaaa
cctgaagaactggaagaggaaggagatgtcgaggaaggatatcgtcgagaaataagcagt
agcccagaaagctgcccggaagaaattaagcatgaagaatttgatgtaaatttgtcatcg
gatgctgctttcggaatcctgaaagaacccctcactatcatccatccgcttctgggttgc
agcgacccctatgctctgacaagggtactacatgaagtggagccaagatacgtggttctt
tatgacgcagagctaacctttgttcggcagcttgaaatttacagggcgagtaggcctggg
aaacctctgagggtttactttcttatatacggaggttcaactgaggaacaacgctatctc
actgctttgcggaaagaaaaggaagcttttgaaaaactcataagggaaaaagcaagcatg
gttgtccctgaagaaagagaaggcagagatgaaacaaacttagacctagtaagaggcaca
gcatctgcagatgtttccactgacactcggaaagccggtggccaggaacagaatggtaca
cagcaaagcatagttgtggatatgcgtgaatttcgaagtgagcttccatctctgatccat
cgtcggggcattgacattgaacccgtgactttagaggttggagattacatcctcactcca
gaaatgtgcgtggagcgcaagagtatcagtgatttaatcggctctttaaataacggccgc
ctctacagccagtgcatctccatgtcccgctactacaagcgtcccgtgcttctgattgag
tttgaccctagcaagcctttctctctcacttcccgaggtgccttgtttcaggagatctcc
agcaatgacattagttccaaactcactcttcttacacttcacttccccagactacggatt
ctctggtgcccctctcctcatgcaacggcggagttgtttgaggagctgaaacaaagcaag
ccacagcctgatgcggcgacagcactggccattacagcagattctgaaacccttcccgag
tcagagaagtataatcctggtccccaagacttcttgttaaaaatgccaggggtgaatgcc
aaaaactgccgctccttgatgcaccacgttaagaacatcgcagaattagcagccctgtca
caagacgagctcacgagtattctggggaatgctgcaaatgccaaacagctttatgatttc
attcacacctcttttgcagaagtcgtatcaaaaggaaaagggaaaaagtga

DBGET integrated database retrieval system