KEGG   Homo sapiens (human): 2081Help
Entry
2081              CDS       T01001                                 

Gene name
ERN1, IRE1, IRE1P, IRE1a, hIRE1p
Definition
(RefSeq) endoplasmic reticulum to nucleus signaling 1 (EC:2.7.11.1)
  KO
K08852  
serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    2081 (ERN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    2081 (ERN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2081 (ERN1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2081 (ERN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2081 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     2081 (ERN1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IRE family
   2081 (ERN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q24.2
AA seq 977 aa AA seqDB search
MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP
VLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYMGK
KQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYF
DYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKV
MHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMV
HEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWL
LIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSR
DVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQ
KELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRASNHSLCSG
SSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPY
YFHEPPEPQPPVTPDAL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccggcggctgctgctgctgctgacgctgctgctgcccggcctcgggattttt
ggaagtaccagcacagtgacgcttcctgaaaccttgttgtttgtgtcaacgctggatgga
agtttgcatgctgtcagcaagaggacaggctcaatcaaatggactttaaaagaagatcca
gtcctgcaggtcccaacacatgtggaagagcctgcctttctcccagatcctaatgatggc
agcctgtatacgcttggaagcaagaataatgaaggcctgacgaaacttccttttaccatc
ccagaattggtgcaggcatccccatgccgaagttcagatggaatcctctacatgggtaaa
aagcaggacatctggtatgttattgacctcctgaccggagagaagcagcagactttgtca
tcggcctttgcagatagtctctgcccatcaacctctcttctgtatcttgggcgaacagaa
tacaccatcaccatgtacgacaccaaaacccgagagctccggtggaatgccacctacttt
gactatgcggcctcactgcctgaggacgacgtggactacaagatgtcccactttgtgtcc
aatggtgatgggctggtggtgactgtggacagtgaatctggggacgtcctgtggatccaa
aactacgcctcccctgtggtggccttttatgtctggcagcgggagggtctgaggaaggtg
atgcacatcaatgtcgctgtggagaccctgcgctatctgaccttcatgtctggggaggtg
gggcgcatcacaaagtggaagtacccgttccccaaggagacagaggccaagagcaagctg
acgcccactctgtatgttgggaaatactctaccagcctctatgcctctccctcaatggta
cacgagggggttgctgtcgtgccccgcggcagcacacttcctttgctggaagggccccag
actgatggcgtcaccattggggacaagggggagtgtgtgatcacgcccagcacggacgtc
aagtttgatcccggactcaaaagcaagaacaagctcaactacttgaggaattactggctt
ctgataggacaccatgaaaccccactgtctgcgtctaccaagatgctggagagatttccc
aacaatctacccaaacatcgggaaaatgtgattcctgctgattcagagaaaaagagcttt
gaggaagttatcaacctggttgaccagacttcagaaaacgcacctaccaccgtgtctcgg
gatgtggaggagaagcccgcccatgcccctgcccggcccgaggcccccgtggactccatg
cttaaggacatggctaccatcatcctgagcaccttcctgctgattggctgggtggccttc
atcatcacctatcccctgagcatgcatcagcagcagcagctccagcaccagcagttccag
aaggaactggagaagatccagctcctgcagcagcagcagcagcagctgcccttccaccca
cctggagacacggctcaggacggcgagctcctggacacgtctggcccgtactcagagagc
tcgggcaccagcagccccagcacgtcccccagggcctccaaccactcgctctgctccggc
agctctgcctccaaggctggcagcagcccctccctggaacaagacgatggagatgaggaa
accagcgtggtgatagttgggaaaatttccttctgtcccaaggatgtcctgggccatgga
gctgagggcacaattgtgtaccggggcatgtttgacaaccgcgacgtggccgtgaagagg
atcctccccgagtgttttagcttcgcagaccgtgaggtccagctgttgcgagaatcggat
gagcacccgaacgtgatccgctacttctgcacggagaaggaccggcaattccagtacatt
gccatcgagctgtgtgcagccaccctgcaagagtatgtggagcagaaggactttgcgcat
ctcggcctggagcccatcaccttgctgcagcagaccacctcgggcctggcccacctccac
tccctcaacatcgttcacagagacctaaagccacacaacatcctcatatccatgcccaat
gcacacggcaagatcaaggccatgatctccgactttggcctctgcaagaagctggcagtg
ggcagacacagtttcagccgccgatctggggtgcctggcacagaaggctggatcgctcca
gagatgctgagcgaagactgtaaggagaaccctacctacacggtggacatcttttctgca
ggctgcgtcttttactacgtaatctctgagggcagccacccttttggcaagtccctgcag
cggcaggccaacatcctcctgggtgcctgcagccttgactgcttgcacccagagaagcac
gaagacgtcattgcacgtgaattgatagagaagatgattgcgatggatcctcagaaacgc
ccctcagcgaagcatgtgctcaaacacccgttcttctggagcctagagaagcagctccag
ttcttccaggacgtgagcgacagaatagaaaaggaatccctggatggcccgatcgtgaag
cagttagagagaggcgggagagccgtggtgaagatggactggcgggagaacatcactgtc
cccctccagacagacctgcgtaaattcaggacctataaaggtggttctgtcagagatctc
ctccgagccatgagaaataagaagcaccactaccgggagctgcctgcagaggtgcgggag
acgctggggtccctccccgacgacttcgtgtgctacttcacatctcgcttcccccacctc
ctcgcacacacctaccgggccatggagctgtgcagccacgagagactcttccagccctac
tacttccacgagcccccagagccccagcccccagtgactccagacgccctctga

DBGET integrated database retrieval system