KEGG   Homo sapiens (human): 2098Help
Entry
2098              CDS       T01001                                 

Gene name
ESD, FGH
Definition
(RefSeq) esterase D (EC:3.1.2.12 3.1.1.56)
  KO
K01070  
S-formylglutathione hydrolase [EC:3.1.2.12]
Organism
hsa  Homo sapiens (human)
Pathway
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2098 (ESD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.12  S-formylglutathione hydrolase
     2098 (ESD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.1-q14.2
AA seq 282 aa AA seqDB search
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQN
FISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRM
YSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVL
CPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcattgaagcagatttccagcaacaagtgctttgggggattgcagaaagtttttgaa
catgacagtgttgaactaaactgcaaaatgaaatttgctgtctacttaccaccaaaggca
gaaacaggaaagtgccctgcactgtattggctctcaggtttaacttgcacagagcaaaat
tttatatcaaaatctggttatcatcagtctgcttcagaacatggtcttgttgtcattgct
ccagataccagccctcgtggctgcaatattaaaggtgaagatgagagctgggactttggc
actggtgctggattttatgttgatgccactgaagatccttggaaaaccaactacagaatg
tactcttatgtcacagaggagcttccccaactcataaatgccaattttccagtggatccc
caaaggatgtctatttttggccactccatgggaggtcatggagctctgatctgtgctttg
aaaaatcctggaaaatacaaatctgtgtcagcatttgctccaatttgcaaccctgtactc
tgtccctggggcaaaaaagcctttagtggatatttgggaacagatcaaagtaaatggaag
gcttatgatgctacccaccttgtgaaatcctatccaggatctcagctggacatactaatt
gatcaagggaaagatgaccagtttcttttagatggacagttactccctgataacttcata
gctgcctgtacagaaaagaaaatccccgttgtttttcgattgcaagagggttatgatcat
agctactacttcattgcaacctttattactgaccacatcagacatcatgctaaatacctg
aatgcatga

DBGET integrated database retrieval system