KEGG   Homo sapiens (human): 21Help
Entry
21                CDS       T01001                                 

Gene name
ABCA3, ABC-C, ABC3, EST111653, LBM180, SMDP3
Definition
ATP-binding cassette, sub-family A (ABC1), member 3
Orthology
K05643  
ATP-binding cassette, subfamily A (ABC1), member 3
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Disease
H00217  
Pulmonary surfactant metabolism dysfunction (SMDP)
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 1704 aa AA seqDB search
MAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYPGQ
SIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFEDYI
RYDNCSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEGWH
TTSLFPLFPNPGPREPTSPDGGEPGYIREGFLAVQHAVDRAIMEYHADAATRQLFQRLTV
TIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTALTIARAVVQEKERRLKEYMRMMGLS
SWLHWSAWFLLFFLFLLIAASFMTLLFCVKVKPNVAVLSRSDPSLVLAFLLCFAISTISF
SFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAMAMGAQ
LIGKFEAKGMGIQWRDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYMEAVFPGQFGV
PQPWYFFIMPSYWCGKPRAVAGKEEEDSDPEKALRNEYFEAEPEDLVAGIKIKHLSKVFR
VGNKDRAAVRDLNLNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYISGYEISQD
MVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHIIGLEDKWNS
RSRFLSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSDRTIVLTT
HFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEDISQLVHHH
VPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVG
KLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPSDGIGALIEEERTAVKLNTG
LALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCVTLALLAINYSSELFDDPMLRLTL
GEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFN
ERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQP
RSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQFVSGVHVAS
FWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHMADTLLLLLLYGWAIIPLMYLMN
FFFLGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSKTLDHVFLVLPNHCLGMA
VSSFYENYETRRYCTSSEVAAHYCKKYNIQYQENFYAWSAPGVGRFVASMAASGCAYLIL
LFLIETNLLQRLRGILCALRRRRTLTELYTRMPVLPEDQDVADERTRILAPSPDSLLHTP
LIIKELSKVYEQRVPLLAVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGEESLTSGDA
FVGGHRISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIGACVENTLR
GLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARA
RESGKAIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLRAKVQSEGQ
QEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSV
SQISLEQVFLSFAHLQPPTAEEGR
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctcaggcagctggcgctcctcctctggaagaactacaccctgcagaagcgg
aaggtcctggtgacggtcctggaactcttcctgccattgctgttttctgggatcctcatc
tggctccgcttgaagattcagtcggaaaatgtgcccaacgccaccatctacccgggccag
tccatccaggagctgcctctgttcttcaccttccctccgccaggagacacctgggagctt
gcctacatcccttctcacagtgacgctgccaagaccgtcactgagacagtgcgcagggca
cttgtgatcaacatgcgagtgcgcggctttccctccgagaaggactttgaggactacatt
aggtacgacaactgctcgtccagcgtgctggccgccgtggtcttcgagcaccccttcaac
cacagcaaggagcccctgccgctggcggtgaaatatcacctacggttcagttacacacgg
agaaattacatgtggacccaaacaggctcctttttcctgaaagagacagaaggctggcac
actacttcccttttcccgcttttcccaaacccaggaccaagggaacctacatcccctgat
ggcggagaacctgggtacatccgggaaggcttcctggccgtgcagcatgctgtggaccgg
gccatcatggagtaccatgccgatgccgccacacgccagctgttccagagactgacggtg
accatcaagaggttcccgtacccgccgttcatcgcagaccccttcctcgtggccatccag
taccagctgcccctgctgctgctgctcagcttcacctacaccgcgctcaccattgcccgt
gctgtcgtgcaggagaaggaaaggaggctgaaggagtacatgcgcatgatggggctcagc
agctggctgcactggagtgcctggttcctcttgttcttcctcttcctcctcatcgccgcc
tccttcatgaccctgctcttctgtgtcaaggtgaagccaaatgtagccgtgctgtcccgc
agcgacccctccctggtgctcgccttcctgctgtgcttcgccatctctaccatctccttc
agcttcatggtcagcaccttcttcagcaaagccaacatggcagcagccttcggaggcttc
ctctacttcttcacctacatcccctacttcttcgtggcccctcggtacaactggatgact
ctgagccagaagctctgctcctgcctcctgtctaatgtcgccatggcaatgggagcccag
ctcattgggaaatttgaggcgaaaggcatgggcatccagtggcgagacctcctgagtccc
gtcaacgtggacgacgacttctgcttcgggcaggtgctggggatgctgctgctggactct
gtgctctatggcctggtgacctggtacatggaggccgtcttcccagggcagttcggcgtg
cctcagccctggtacttcttcatcatgccctcctattggtgtgggaagccaagggcggtt
gcagggaaggaggaagaagacagtgaccccgagaaagcactcagaaacgagtactttgaa
gccgagccagaggacctggtggcggggatcaagatcaagcacctgtccaaggtgttcagg
gtgggaaataaggacagggcggccgtcagagacctgaacctcaacctgtacgagggacag
atcaccgtcctgctgggccacaacggtgccgggaagaccaccaccctctccatgctcaca
ggtctctttccccccaccagtggacgggcatacatcagcgggtatgaaatttcccaggac
atggttcagatccggaagagcctgggcctgtgcccgcagcacgacatcctgtttgacaac
ttgacagtcgcagagcacctttatttctacgcccagctgaagggcctgtcacgtcagaag
tgccctgaagaagtcaagcagatgctgcacatcatcggcctggaggacaagtggaactca
cggagccgcttcctgagcgggggcatgaggcgcaagctctccatcggcatcgccctcatc
gcaggctccaaggtgctgatactggacgagcccacctcgggcatggacgccatctccagg
agggccatctgggatcttcttcagcggcagaaaagtgaccgcaccatcgtgctgaccacc
cacttcatggacgaggctgacctgctgggagaccgcatcgccatcatggccaagggggag
ctgcagtgctgcgggtcctcgctgttcctcaagcagaaatacggtgccggctatcacatg
acgctggtgaaggagccgcactgcaacccggaagacatctcccagctggtccaccaccac
gtgcccaacgccacgctggagagcagcgctggggccgagctgtctttcatccttcccaga
gagagcacgcacaggtttgaaggtctctttgctaaactggagaagaagcagaaagagctg
ggcattgccagctttggggcatccatcaccaccatggaggaagtcttccttcgggtcggg
aagctggtggacagcagtatggacatccaggccatccagctccctgccctgcagtaccag
cacgagaggcgcgccagcgactgggctgtggacagcaacctctgtggggccatggacccc
tccgacggcattggagccctcatcgaggaggagcgcaccgctgtcaagctcaacactggg
ctcgccctgcactgccagcaattctgggccatgttcctgaagaaggccgcatacagctgg
cgcgagtggaaaatggtggcggcacaggtcctggtgcctctgacctgcgtcaccctggcc
ctcctggccatcaactactcctcggagctcttcgacgaccccatgctgaggctgaccttg
ggcgagtacggcagaaccgtcgtgcccttctcagttcccgggacctcccagctgggtcag
cagctgtcagagcatctgaaagacgcactgcaggctgagggacaggagccccgcgaggtg
ctcggtgacctggaggagttcttgatcttcagggcttctgtggaggggggcggctttaat
gagcggtgccttgtggcagcgtccttcagagatgtgggagagcgcacggtcgtcaacgcc
ttgttcaacaaccaggcgtaccactctccagccactgccctggccgtcgtggacaacctt
ctgttcaagctgctgtgcgggcctcacgcctccattgtggtctccaacttcccccagccc
cggagcgccctgcaggctgccaaggaccagtttaacgagggccggaagggattcgacatt
gccctcaacctgctcttcgccatggcattcttggccagcacgttctccatcctggcggtc
agcgagagggccgtgcaggccaagcatgtgcagtttgtgagtggagtccacgtggccagt
ttctggctctctgctctgctgtgggacctcatctccttcctcatccccagtctgctgctg
ctggtggtgtttaaggccttcgacgtgcgtgccttcacgcgggacggccacatggctgac
accctgctgctgctcctgctctacggctgggccatcatccccctcatgtacctgatgaac
ttcttcttcttgggggcggccactgcctacacgaggctgaccatcttcaacatcctgtca
ggcatcgccaccttcctgatggtcaccatcatgcgcatcccagctgtaaaactggaagaa
ctttccaaaaccctggatcacgtgttcctggtgctgcccaaccactgtctggggatggca
gtcagcagtttctacgagaactacgagacgcggaggtactgcacctcctccgaggtcgcc
gcccactactgcaagaaatataacatccagtaccaggagaacttctatgcctggagcgcc
ccgggggtcggccggtttgtggcctccatggccgcctcagggtgcgcctacctcatcctg
ctcttcctcatcgagaccaacctgcttcagagactcaggggcatcctctgcgccctccgg
aggaggcggacactgacagaattatacacccggatgcctgtgcttcctgaggaccaagat
gtagcggacgagaggacccgcatcctggcccccagcccggactccctgctccacacacct
ctgattatcaaggagctctccaaggtgtacgagcagcgggtgcccctcctggccgtggac
aggctctccctcgcggtgcagaaaggggagtgcttcggcctgctgggcttcaatggagcc
gggaagaccacgactttcaaaatgctgaccggggaggagagcctcacttctggggatgcc
tttgtcgggggtcacagaatcagctctgatgtcggaaaggtgcggcagcggatcggctac
tgcccgcagtttgatgccttgctggaccacatgacaggccgggagatgctggtcatgtac
gctcggctccggggcatccctgagcgccacatcggggcctgcgtggagaacactctgcgg
ggcctgctgctggagccacatgccaacaagctggtcaggacgtacagtggtggtaacaag
cggaagctgagcaccggcatcgccctgatcggagagcctgctgtcatcttcctggacgag
ccgtccactggcatggaccccgtggcccggcgcctgctttgggacaccgtggcacgagcc
cgagagtctggcaaggccatcatcatcacctcccacagcatggaggagtgtgaggccctg
tgcacccggctggccatcatggtgcaggggcagttcaagtgcctgggcagcccccagcac
ctcaagagcaagttcggcagcggctactccctgcgggccaaggtgcagagtgaagggcaa
caggaggcgctggaggagttcaaggccttcgtggacctgacctttccaggcagcgtcctg
gaagatgagcaccaaggcatggtccattaccacctgccgggccgtgacctcagctgggcg
aaggttttcggtattctggagaaagccaaggaaaagtacggcgtggacgactactccgtg
agccagatctcgctggaacaggtcttcctgagcttcgcccacctgcagccgcccaccgca
gaggaggggcgatga

DBGET integrated database retrieval system