KEGG   Homo sapiens (human): 2100Help
Entry
2100              CDS       T01001                                 

Gene name
ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  
estrogen receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Estrogen signaling pathway
Prolactin signaling pathway
Breast cancer
Drug target
Acolbifene hydrochloride: 
Afimoxifene: 
Arzoxifene hydrochloride: 
Bazedoxifene: 
Clomifene (DG00474): 
Conjugated estrogens (DG00465): 
Dienestrol: 
Diethylstilbestrol (DG00466): 
Droloxifene (DG01265): 
Enclomiphene: 
Epitiostanol: 
Equilin: 
Erteberel: 
Estradiol (DG00462): 
Estriol (DG00463): 
Estrogens, esterified: 
Estrone (DG00464): 
Ethinylestradiol (DG00461): 
Fispemifene: 
Fulvestrant: 
Idoxifene: 
Lasofoxifene: 
Levormeloxifene fumarate: 
Mepitiostane: 
Mestranol: 
Miproxifene phosphate: 
Nafoxidine hydrochloride: 
Nitromifene citrate: 
Ormeloxifen: 
Ospemifene: 
Polyestradiol phosphate: 
Prinaberel: 
Promestriene: 
Raloxifene (DG00476): 
Tamoxifen (DG00734): 
Tibolone: 
Toremifene (DG00735): 
Trioxifene mesylate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2100 (ESR2)
   04917 Prolactin signaling pathway
    2100 (ESR2)
 Human Diseases
  Cancers
   05224 Breast cancer
    2100 (ESR2)
  Drug resistance
   01522 Endocrine resistance
    2100 (ESR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2100 (ESR2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2100 (ESR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 530 aa AA seqDB search
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaaaactcaccatctagccttaattctccttcctcctacaactgcagtcaa
tccatcttacccctggagcacggctccatatacataccttcctcctatgtagacagccac
catgaatatccagccatgacattctatagccctgctgtgatgaattacagcattcccagc
aatgtcactaacttggaaggtgggcctggtcggcagaccacaagcccaaatgtgttgtgg
ccaacacctgggcacctttctcctttagtggtccatcgccagttatcacatctgtatgcg
gaacctcaaaagagtccctggtgtgaagcaagatcgctagaacacaccttacctgtaaac
agagagacactgaaaaggaaggttagtgggaaccgttgcgccagccctgttactggtcca
ggttcaaagagggatgctcacttctgcgctgtctgcagcgattacgcatcgggatatcac
tatggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacat
aatgattatatttgtccagctacaaatcagtgtacaatcgataaaaaccggcgcaagagc
tgccaggcctgccgacttcggaagtgttacgaagtgggaatggtgaagtgtggctcccgg
agagagagatgtgggtaccgccttgtgcggagacagagaagtgccgacgagcagctgcac
tgtgccggcaaggccaagagaagtggcggccacgcgccccgagtgcgggagctgctgctg
gacgccctgagccccgagcagctagtgctcaccctcctggaggctgagccgccccatgtg
ctgatcagccgccccagtgcgcccttcaccgaggcctccatgatgatgtccctgaccaag
ttggccgacaaggagttggtacacatgatcagctgggccaagaagattcccggctttgtg
gagctcagcctgttcgaccaagtgcggctcttggagagctgttggatggaggtgttaatg
atggggctgatgtggcgctcaattgaccaccccggcaagctcatctttgctccagatctt
gttctggacagggatgaggggaaatgcgtagaaggaattctggaaatctttgacatgctc
ctggcaactacttcaaggtttcgagagttaaaactccaacacaaagaatatctctgtgtc
aaggccatgatcctgctcaattccagtatgtaccctctggtcacagcgacccaggatgct
gacagcagccggaagctggctcacttgctgaacgccgtgaccgatgctttggtttgggtg
attgccaagagcggcatctcctcccagcagcaatccatgcgcctggctaacctcctgatg
ctcctgtcccacgtcaggcatgcgagtaacaagggcatggaacatctgctcaacatgaag
tgcaaaaatgtggtcccagtgtatgacctgctgctggagatgctgaatgcccacgtgctt
cgcgggtgcaagtcctccatcacggggtccgagtgcagcccggcagaggacagtaaaagc
aaagagggctcccagaacccacagtctcagtga

DBGET integrated database retrieval system