KEGG   Homo sapiens (human): 2100Help
Entry
2100              CDS       T01001                                 

Gene name
ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  estrogen receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
N00286  Nuclear-initiated estrogen signaling pathway
Drug target
Acolbifene hydrochloride: D02758
Afimoxifene: D06551
Arzoxifene hydrochloride: D02993
Bazedoxifene: D03062
Chlorotrianisene: D00269
Clometherone: D03551
Clomifene (DG00474): D00962 D07726
Delmadinone acetate: D03675
Dienestrol: D00898
Diethylstilbestrol (DG00466): D00577 D00946 D07826
Droloxifene (DG01265): D03911 D03912
Enclomiphene (DG01992): D08910 D10876
Epitiostanol: D01265
Equilin: D04041
Erteberel: D09899
Estradiol (DG00462): D00105 D01413 D01617 D01953 D04061 D04063 D04064 D04065 D07918 D07919
Estriol (DG00463): D00185 D01986 D01989 D07920 D07921
Estrogens, esterified: D04071
Estrone (DG00464): D00067 D00312 D00948
Fispemifene: D10008
Fulvestrant: D01161
Hexestrol: D01641
Hexestrol diacetate: D02018
Idoxifene: D04496
Lasofoxifene: D04672
Levormeloxifene fumarate: D09834
Mepitiostane: D01602
Mestranol: D00575
Miproxifene phosphate: D01853
Nafoxidine hydrochloride: D05106
Nitromifene citrate: D05192
Ormeloxifen: D08301
Prasterone (DG00141): D01616 D08409
Prinaberel: D06631
Promestriene: D07221
Raloxifene (DG00476): D02217 D08465 D10606
Tamoxifen (DG00734): D00966 D08559
Toremifene (DG00735): D00967 D08620
Trioxifene mesylate: D06245
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2100 (ESR2)
   04917 Prolactin signaling pathway
    2100 (ESR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2100 (ESR2)
   05224 Breast cancer
    2100 (ESR2)
  Drug resistance
   01522 Endocrine resistance
    2100 (ESR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2100 (ESR2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2100 (ESR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 2100
NCBI-ProteinID: NP_001428
OMIM: 601663
HGNC: 3468
Ensembl: ENSG00000140009
Vega: OTTHUMG00000141306
Pharos: Q92731(Tclin)
UniProt: Q92731 Q7LCB3
Structure
PDB: 

Jmol
Position
14q23.2-q23.3
AA seq 530 aa AA seqDB search
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaaaactcaccatctagccttaattctccttcctcctacaactgcagtcaa
tccatcttacccctggagcacggctccatatacataccttcctcctatgtagacagccac
catgaatatccagccatgacattctatagccctgctgtgatgaattacagcattcccagc
aatgtcactaacttggaaggtgggcctggtcggcagaccacaagcccaaatgtgttgtgg
ccaacacctgggcacctttctcctttagtggtccatcgccagttatcacatctgtatgcg
gaacctcaaaagagtccctggtgtgaagcaagatcgctagaacacaccttacctgtaaac
agagagacactgaaaaggaaggttagtgggaaccgttgcgccagccctgttactggtcca
ggttcaaagagggatgctcacttctgcgctgtctgcagcgattacgcatcgggatatcac
tatggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacat
aatgattatatttgtccagctacaaatcagtgtacaatcgataaaaaccggcgcaagagc
tgccaggcctgccgacttcggaagtgttacgaagtgggaatggtgaagtgtggctcccgg
agagagagatgtgggtaccgccttgtgcggagacagagaagtgccgacgagcagctgcac
tgtgccggcaaggccaagagaagtggcggccacgcgccccgagtgcgggagctgctgctg
gacgccctgagccccgagcagctagtgctcaccctcctggaggctgagccgccccatgtg
ctgatcagccgccccagtgcgcccttcaccgaggcctccatgatgatgtccctgaccaag
ttggccgacaaggagttggtacacatgatcagctgggccaagaagattcccggctttgtg
gagctcagcctgttcgaccaagtgcggctcttggagagctgttggatggaggtgttaatg
atggggctgatgtggcgctcaattgaccaccccggcaagctcatctttgctccagatctt
gttctggacagggatgaggggaaatgcgtagaaggaattctggaaatctttgacatgctc
ctggcaactacttcaaggtttcgagagttaaaactccaacacaaagaatatctctgtgtc
aaggccatgatcctgctcaattccagtatgtaccctctggtcacagcgacccaggatgct
gacagcagccggaagctggctcacttgctgaacgccgtgaccgatgctttggtttgggtg
attgccaagagcggcatctcctcccagcagcaatccatgcgcctggctaacctcctgatg
ctcctgtcccacgtcaggcatgcgagtaacaagggcatggaacatctgctcaacatgaag
tgcaaaaatgtggtcccagtgtatgacctgctgctggagatgctgaatgcccacgtgctt
cgcgggtgcaagtcctccatcacggggtccgagtgcagcccggcagaggacagtaaaagc
aaagagggctcccagaacccacagtctcagtga

DBGET integrated database retrieval system