KEGG   Homo sapiens (human): 2101Help
Entry
2101              CDS       T01001                                 

Gene name
ESRRA, ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Definition
(RefSeq) estrogen related receptor alpha
  KO
K08552  
estrogen-related receptor alpha
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2101 (ESRRA)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    2101 (ESRRA)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   2101 (ESRRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 423 aa AA seqDB search
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccaggtggtgggcattgagcctctctacatcaaggcagagccggccagccct
gacagtccaaagggttcctcggagacagagaccgagcctcctgtggccctggcccctggt
ccagctcccactcgctgcctcccaggccacaaggaagaggaggatggggagggggctggg
cctggcgagcagggcggtgggaagctggtgctcagctccctgcccaagcgcctctgcctg
gtctgtggggacgtggcctccggctaccactatggtgtggcatcctgtgaggcctgcaaa
gccttcttcaagaggaccatccaggggagcatcgagtacagctgtccggcctccaacgag
tgtgagatcaccaagcggagacgcaaggcctgccaggcctgccgcttcaccaagtgcctg
cgggtgggcatgctcaaggagggagtgcgcctggaccgcgtccggggtgggcggcagaag
tacaagcggcggccggaggtggacccactgcccttcccgggccccttccctgctgggccc
ctggcagtcgctggaggcccccggaagacagcagccccagtgaatgcactggtgtctcat
ctgctggtggttgagcctgagaagctctatgccatgcctgaccccgcaggccctgatggg
cacctcccagccgtggctaccctctgtgacctctttgaccgagagattgtggtcaccatc
agctgggccaagagcatcccaggcttctcatcgctgtcgctgtctgaccagatgtcagta
ctgcagagcgtgtggatggaggtgctggtgctgggtgtggcccagcgctcactgccactg
caggatgagctggccttcgctgaggacttagtcctggatgaagagggggcacgggcagct
ggcctgggggaactgggggctgccctgctgcaactagtgcggcggctgcaggccctgcgg
ctggagcgagaggagtatgttctactaaaggccttggcccttgccaattcagactctgtg
cacatcgaagatgccgaggctgtggagcagctgcgagaagctctgcacgaggccctgctg
gagtatgaagccggccgggctggccccggagggggtgctgagcggcggcgggcgggcagg
ctgctgctcacgctaccgctcctccgccagacagcgggcaaagtgctggcccatttctat
ggggtgaagctggagggcaaggtgcccatgcacaagctgttcttggagatgctcgaggcc
atgatggactga

DBGET integrated database retrieval system