KEGG   Homo sapiens (human): 2103Help
Entry
2103              CDS       T01001                                 

Gene name
ESRRB, DFNB35, ERR2, ERRb, ESRL2, NR3B2
Definition
(RefSeq) estrogen related receptor beta
  KO
K08553  
estrogen-related receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Signaling pathways regulating pluripotency of stem cells
Disease
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2103 (ESRRB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2103 (ESRRB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    2103 (ESRRB)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   2103 (ESRRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 508 aa AA seqDB search
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKVGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSP
TPLNERGRQISPSTRTPGGQGKHLWLTM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggacgacaggcacctgggctccagctgcggctccttcatcaagactgagccg
tccagcccgtcctcgggcatcgatgccctcagccaccacagccccagtggctcgtccgac
gccagcggcggctttggcctggccctgggcacccacgccaacggtctggactcgccaccc
atgtttgcaggcgccgggctgggaggcaccccatgccgcaagagctacgaggactgtgcc
agcggcatcatggaggactcggccatcaagtgcgagtacatgctcaacgccatccccaag
cgcctgtgcctcgtgtgcggggacattgcctctggctaccactacggcgtggcctcctgc
gaggcttgcaaggccttcttcaagaggactatccaagggaacattgagtacagctgcccg
gccaccaacgagtgcgagatcaccaaacggaggcgcaagtcctgccaggcctgccgcttc
atgaaatgcctcaaagtggggatgctgaaggaaggtgtgcgccttgatcgagtgcgtgga
ggccgtcagaaatacaagcgacggctggactcagagagcagcccatacctgagcttacaa
atttctccacctgctaaaaagccattgaccaagattgtctcatacctactggtggctgag
ccggacaagctctatgccatgcctccccctggtatgcctgagggggacatcaaggccctg
accactctctgtgacctggcagaccgagagcttgtggtcatcattggctgggccaagcac
atcccaggcttctcaagcctctccctgggggaccagatgagcctgctgcagagtgcctgg
atggaaatcctcatcctgggcatcgtgtaccgctcgctgccctatgacgacaagctggtg
tacgctgaggactacatcatggatgaggagcactcccgcctcgcggggctgctggagctc
taccgggccatcctgcagctggtacgcaggtacaagaagctcaaggtggagaaggaggag
tttgtgacgctcaaggccctggccctcgccaactccgattccatgtacatcgaggatcta
gaggctgtccagaagctgcaggacctgctgcacgaggcactgcaggactacgagctgagc
cagcgccatgaggagccctggaggacgggcaagctgctgctgacactgccgctgctgcgg
cagacggccgccaaggccgtgcagcacttctatagcgtcaaactgcagggcaaagtgccc
atgcacaaactcttcctggagatgctggaggccaaggttggccaagagcagcttagagga
tctcccaaggatgaaagaatgtcaagccatgatggaaaatgccccttccaatcagctgcc
ttcacaagcagggatcagagcaactccccggggatccccaatccacgcccttctagtcca
acccccctcaatgagagaggcaggcagatctcacccagcactaggacaccaggaggccag
ggaaagcatctctggctcaccatgtaa

DBGET integrated database retrieval system