KEGG   Homo sapiens (human): 2113Help
Entry
2113              CDS       T01001                                 

Gene name
ETS1, ETS-1, EWSR2, c-ets-1, p54
Definition
(RefSeq) ETS proto-oncogene 1, transcription factor
  KO
K02678  
C-ets-1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Cellular senescence
HTLV-I infection
Pathways in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2113 (ETS1)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    2113 (ETS1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2113 (ETS1)
   05211 Renal cell carcinoma
    2113 (ETS1)
  Infectious diseases
   05166 HTLV-I infection
    2113 (ETS1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2113 (ETS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P14921(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.3
AA seq 441 aa AA seqDB search
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccctccccggatatggaatgtgcagatgtcccactattaactccaagc
agcaaagaaatgatgtctcaagcattaaaagctactttcagtggtttcactaaagaacag
caacgactggggatcccaaaagacccccggcagtggacagaaacccatgttcgggactgg
gtgatgtgggctgtgaatgaattcagcctgaaaggtgtagacttccagaagttctgtatg
aatggagcagccctctgcgccctgggtaaagactgctttctcgagctggccccagacttt
gttggggacatcttatgggaacatctagagatcctgcagaaagaggatgtgaaaccatat
caagttaatggagtcaacccagcctatccagaatcccgctatacctcggattacttcatt
agctatggtattgagcatgcccagtgtgttccaccatcggagttctcagagcccagcttc
atcacagagtcctatcagacgctccatcccatcagctcggaagagctcctctccctcaag
tatgagaatgactacccctcggtcattctccgagaccctctccagacagacaccttgcag
aatgactactttgctatcaaacaagaagtcgtcaccccagacaacatgtgcatggggagg
accagtcgtggtaaactcgggggccaggactcttttgaaagcatagagagctacgatagt
tgtgatcgcctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccggctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgggaccgtgctgacctcaataaggacaagcctgtc
attcctgctgctgccctagctggctacacaggcagtggaccaatccagctatggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaaactttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattacgacaaaaac
atcatccacaagacagcggggaaacgctacgtgtaccgctttgtgtgtgacctgcagagc
ctgctggggtacacccctgaggagctgcacgccatgctggacgtcaagccagatgccgac
gagtga

DBGET integrated database retrieval system