KEGG   Homo sapiens (human): 2115Help
Entry
2115              CDS       T01001                                 

Gene name
ETV1, ER81
Definition
(RefSeq) ETS variant 1
  KO
K09431  
ets translocation variant 1
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00024  
Prostate cancer
H00035  
Ewing's sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2115 (ETV1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2115 (ETV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p21.3
AA seq 477 aa AA seqDB search
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAE
AQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYN
VSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSY
PMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNT
MVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
FYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRG
MEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggatggattttatgaccagcaagtgccttacatggtcaccaatagtcagcgtgggaga
aattgtaacgagaaaccaacaaatgtcaggaaaagaaaattcattaacagagatctggct
catgattcagaagaactctttcaagatctaagtcaattacaggaaacatggcttgcagaa
gctcaggtacctgacaatgatgagcagtttgtaccagactatcaggctgaaagtttggct
tttcatggcctgccactgaaaatcaagaaagaaccccacagtccatgttcagaaatcagc
tctgcctgcagtcaagaacagccctttaaattcagctatggagaaaagtgcctgtacaat
gtcagtgcctatgatcagaagccacaagtgggaatgaggccctccaacccccccacacca
tccagcacgccagtgtccccactgcatcatgcatctccaaactcaactcatacaccgaaa
cctgaccgggccttcccagctcacctccctccatcgcagtccataccagatagcagctac
cccatggaccacagatttcgccgccagctttctgaaccctgtaactcctttcctcctttg
ccgacgatgccaagggaaggacgtcctatgtaccaacgccagatgtctgagccaaacatc
cccttcccaccacaaggctttaagcaggagtaccacgacccagtgtatgaacacaacacc
atggttggcagtgcggccagccaaagctttccccctcctctgatgattaaacaggaaccc
agagattttgcatatgactcagaagtgcctagctgccactccatttatatgaggcaagaa
ggcttcctggctcatcccagcagaacagaaggctgtatgtttgaaaagggccccaggcag
ttttatgatgacacctgtgttgtcccagaaaaattcgatggagacatcaaacaagagcca
ggaatgtatcgggaaggacccacataccaacggcgaggatcacttcagctctggcagttt
ttggtagctcttctggatgacccttcaaattctcattttattgcctggactggtcgaggc
atggaatttaaactgattgagcctgaagaggtggcccgacgttggggcattcagaaaaac
aggccagctatgaactatgataaacttagccgttcactccgctattactatgagaaagga
attatgcaaaaggtggctggagagagatatgtctacaagtttgtgtgtgatccagaagcc
cttttctccatggcctttccagataatcagcgtccactgctgaagacagacatggaacgt
cacatcaacgaggaggacacagtgcctctttctcactttgatgagagcatggcctacatg
ccggaagggggctgctgcaacccccacccctacaacgaaggctacgtgtattaa

DBGET integrated database retrieval system