KEGG   Homo sapiens (human): 212Help
Entry
212               CDS       T01001                                 

Gene name
ALAS2, ALAS-E, ALASE, ANH1, ASB, XLDPP, XLEPP, XLSA
Definition
aminolevulinate, delta-, synthase 2 (EC:2.3.1.37)
Orthology
K00643  
5-aminolevulinate synthase [EC:2.3.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.21
AA seq 587 aa AA seqDB search
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGG
DSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFKTDLPSSLVSVSLRKPFSGPQ
EQEQISGKVTHLIQNNMPGNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQH
FSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELE
QELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKF
VFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVH
AVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFT
TSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRV
GNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW
TAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgcagccatgctgctacagtgctgcccagtgcttgcccggggccccacaagc
ctcctaggcaaggtggttaagactcaccagttcctgtttggtattggacgctgtcccatc
ctggctacccaaggaccaaactgttctcaaatccaccttaaggcaacaaaggctggagga
gattctccatcttgggcgaagggccactgtcccttcatgctgtcggaactccaggatggg
aagagcaagattgtgcagaaggcagccccagaagtccaggaagatgtgaaggctttcaag
acagatctgcctagctccctggtctcagtcagcctaaggaagccattttccggtccccag
gagcaggagcagatctctgggaaggtcacacacctgattcagaacaatatgcctggaaac
tatgtcttcagttatgaccagtttttcagggacaagatcatggagaagaaacaggatcac
acctaccgtgtgttcaagactgtgaaccgctgggctgatgcatatccctttgcccaacat
ttctctgaggcatctgtggcctcaaaggatgtgtccgtctggtgtagtaatgattacctg
ggcatgagccgacaccctcaggtcttgcaagccacacaggagaccctgcagcgtcatggt
gctggagctggtggcacccgcaacatctcaggcaccagtaagtttcatgtggagcttgag
caggagctggctgagctgcaccagaaggactcagccctgctcttctcctcctgctttgtt
gccaatgactctactctcttcaccttggccaagatcctgccagggtgcgagatttactca
gacgcaggcaaccatgcttccatgatccaaggtatccgtaacagtggagcagccaagttt
gtcttcaggcacaatgaccctgaccacctaaagaaacttctagagaagtctaaccctaag
atacccaaaattgtggcctttgagactgtccactccatggatggtgccatctgtcccctc
gaggagttgtgtgatgtgtcccaccagtatggggccctgaccttcgtggatgaggtccat
gctgtaggactgtatgggtcccggggcgctgggattggggagcgtgatggaattatgcat
aagattgacatcatctctggaactcttggcaaggcctttggctgtgtgggcggctacatt
gccagcacccgtgacttggtggacatggtgcgctcctatgctgcaggcttcatctttacc
acttctctgccccccatggtgctctctggagctctagaatctgtgcggctgctcaaggga
gaggagggccaagccctgaggcgagcccaccagcgcaatgtcaagcacatgcgccagcta
ctcatggacaggggccttcctgtcatcccctgccccagccacatcatccccatccgggtg
ggcaatgcagcactcaacagcaagctctgtgatctcctgctctccaagcatggcatctat
gtgcaggccatcaactacccaactgtcccccggggtgaagagctcctgcgcttggcaccc
tccccccaccacagccctcagatgatggaagattttgtggagaagctgctgctggcttgg
actgcggtggggctgcccctccaggatgtgtctgtggctgcctgcaatttctgtcgccgt
cctgtacactttgagctcatgagtgagtgggaacgttcctacttcgggaacatggggccc
cagtatgtcaccacctatgcctga

DBGET integrated database retrieval system