KEGG   Homo sapiens (human): 2122Help
Entry
2122              CDS       T01001                                 

Gene name
MECOM, AML1-EVI-1, EVI1, MDS1, MDS1-EVI1, PRDM3
Definition
MDS1 and EVI1 complex locus
Orthology
K04462  
ecotropic virus integration site 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Pathways in cancer
Chronic myeloid leukemia
Disease
H00004  
Chronic myeloid leukemia (CML)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2122 (MECOM)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2122 (MECOM)
   05220 Chronic myeloid leukemia
    2122 (MECOM)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    2122 (MECOM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.2
AA seq 1116 aa AA seqDB search
MILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEE
LLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEE
DFQQKLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKS
NLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGL
KQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKH
RRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPT
APGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILK
ALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLES
DIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIK
AIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKME
PQSPGEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRA
SGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEAL
KEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFR
APPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSN
LQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAI
LDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVED
EVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSG
LSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSL
SDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagacgaattttacaatgtgaagttctgcatagatgccagtcaaccagatgtt
ggaagctggctcaagtacattagattcgctggctgttatgatcagcacaaccttgttgca
tgccagataaatgatcagatattctatagagtagttgcagacattgcgccgggagaggag
cttctgctgttcatgaagagcgaagactatccccatgaaactatggcgccggatatccac
gaagaacggcaatatcgctgcgaagactgtgaccagctctttgaatctaaggctgaacta
gcagatcaccaaaagtttccatgcagtactcctcactcagcattttcaatggttgaagag
gactttcagcaaaaactcgaaagcgagaatgatctccaagagatacacacgatccaggag
tgtaaggaatgtgaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtca
catactgaagagagggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtcc
aatttaattcgccaccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgt
gccaagcaggttttcacggaccctagcaaccttcagcggcacattcgctctcagcatgtc
ggtgcccgggcccatgcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctc
aaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtctgccataaa
tcctatactcagttttcaaacctttgccgtcataagcgcatgcatgctgattgcagaacc
caaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaataaacac
aggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggccaaggcatt
tcacttcctggaaccccagctatggataaaacgtccatggttaatatgagtcatgccaac
ccgggccttgctgactattttggcgccaataggcatcctgctggtcttacctttccaaca
gctcctggattttcttttagcttccctggtctgtttccttccggcttgtaccacaggcct
cctttgatacctgctagttctcctgttaaaggactatcaagtactgaacagacaaacaaa
agtcaaagtcccctcatgacacatcctcagatactgccagctacacaggatattttgaag
gcactatctaaacacccatctgtaggggacaataagccagtggagctccagcccgagagg
tcctctgaagagaggccctttgagaaaatcagtgaccagtcagagagtagtgaccttgat
gatgtcagtacaccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagt
gacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagta
agccctcttcagaatctggcttcaataaataataagaaagaatacagcaatcattccatt
ttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgattctataaag
gctattgcttctattgctgaaaaatactttggttcaacaggactggtggggctgcaagac
aaaaaagttggagctttaccttacccttccatgtttcccctcccattttttccagcattc
tctcaatcaatgtacccatttcctgatagagacttgagatcgttacctttgaaaatggaa
ccccaatcaccaggtgaagtaaagaaactgcagaagggcagctctgagtccccctttgat
ctcaccactaagcgaaaggatgagaagcccttgactccagtcccctccaagcctccagtg
acacctgccacaagccaagaccagcccctggatctaagtatgggcagtaggagtagagcc
agtgggacaaagctgactgagcctcgaaaaaaccacgtgtttgggggaaaaaaaggaagc
aacgtcgaatcaagacctgcttcagatggttccttgcagcatgcaagacccactcctttc
tttatggaccctatttacagagtagagaaaagaaaactaactgacccacttgaagcttta
aaagagaaatacttgaggccttctccaggattcttgtttcacccacaattccaactgcct
gatcagagaacttggatgtcagctattgaaaacatggcagaaaagctagagagcttcagt
gccctgaaacctgaggccagtgagctcttacagtcagtgccctctatgttcaacttcagg
gcgcctcccaatgccctgccagagaaccttctgcggaagggaaaggagcgctatacctgc
agatactgtggcaagatttttccaaggtctgcaaacctaacacggcacttgagaacccac
acaggagagcagccttacagatgcaaatactgtgacagatcatttagcatatcttctaac
ttgcaaaggcatgttcgcaacatccacaataaagagaagccatttaagtgtcacttatgt
gataggtgttttggtcaacaaaccaatttagacagacacctaaagaaacatgagaatggg
aacatgtccggtacagcaacatcgtcgcctcattctgaactggaaagtacaggtgcgatt
ctggatgacaaagaagatgcttacttcacagaaattcgaaatttcattgggaacagcaac
catggcagccaatctcccaggaatgtggaggagagaatgaatggcagtcattttaaagat
gaaaaggctttggtgaccagtcaaaattcagacttgctggatgatgaagaagttgaagat
gaggtgttgttagatgaggaggatgaagacaatgatattactggaaaaacaggaaaggaa
ccagtgacaagtaatttacatgaaggaaaccctgaggatgactatgaagaaaccagtgcc
ctggagatgagttgcaagacatccccagtgaggtataaagaggaagaatataaaagtgga
ctttctgctctagatcatataaggcacttcacagatagcctcaaaatgaggaaaatggaa
gataatcaatattctgaagctgagctgtcttcttttagtacttcccatgtgccagaggaa
cttaagcagccgttacacagaaagtccaaatcgcaggcatatgctatgatgctgtcactg
tctgacaaggagtccctccattctacatcccacagttcttccaacgtgtggcacagtatg
gccagggctgcggcggaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system