KEGG   Homo sapiens (human): 2122Help
Entry
2122              CDS       T01001                                 

Gene name
MECOM, AML1-EVI-1, EVI1, KMT8E, MDS1, MDS1-EVI1, PRDM3, RUSAT2
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05200  Pathways in cancer
hsa05220  Chronic myeloid leukemia
Network
N00107  EVI-1 overexpression to TGF-beta signaling pathway
Disease
H00004  Chronic myeloid leukemia (CML)
H00867  Radioulnar synostosis with amegakaryocytic thrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2122 (MECOM)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2122 (MECOM)
   05220 Chronic myeloid leukemia
    2122 (MECOM)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    2122 (MECOM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zf-met Zn-ribbon_8 PyrI_C
Motif
Other DBs
NCBI-GeneID: 2122
NCBI-ProteinID: NP_001098548
OMIM: 165215
HGNC: 3498
Ensembl: ENSG00000085276
Vega: OTTHUMG00000158596
Pharos: Q03112(Tbio)
UniProt: Q03112
Position
3q26.2
AA seq 1051 aa AA seqDB search
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKH
PSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPG
EVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKL
TEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNA
LPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLD
EEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALD
HIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKES
LHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgaagactatccccatgaaactatggcgccggatatccacgaagaacggcaa
tatcgctgcgaagactgtgaccagctctttgaatctaaggctgaactagcagatcaccaa
aagtttccatgcagtactcctcactcagcattttcaatggttgaagaggactttcagcaa
aaactcgaaagcgagaatgatctccaagagatacacacgatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaaggttttc
acggaccctagcaaccttcagcggcacattcgctctcagcatgtcggtgcccgggcccat
gcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgccgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgctgac
tattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacctgct
agttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtcccctc
atgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaacac
ccatctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagagagg
ccctttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacacca
agtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagtgat
aaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatcttta
gaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttctatt
gctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttggagct
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcaccaggt
gaagtaaagaaactgcagaagggcagctctgagtccccctttgatctcaccactaagcga
aaggatgagaagcccttgactccagtcccctccaagcctccagtgacacctgccacaagc
caagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaagctg
actgagcctcgaaaaaaccacgtgtttgggggaaaaaaaggaagcaacgtcgaatcaaga
cctgcttcagatggttccttgcagcatgcaagacccactcctttctttatggaccctatt
tacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatacttg
aggccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaacttgg
atgtcagctattgaaaacatggcagaaaagctagagagcttcagtgccctgaaacctgag
gccagtgagctcttacagtcagtgccctctatgttcaacttcagggcgcctcccaatgcc
ctgccagagaaccttctgcggaagggaaaggagcgctatacctgcagatactgtggcaag
atttttccaaggtctgcaaacctaacacggcacttgagaacccacacaggagagcagcct
tacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcaaaggcatgtt
cgcaacatccacaataaagagaagccatttaagtgtcacttatgtgataggtgttttggt
caacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtccggtaca
gcaacatcgtcgcctcattctgaactggaaagtacaggtgcgattctggatgacaaagaa
gatgcttacttcacagaaattcgaaatttcattgggaacagcaaccatggcagccaatct
cccaggaatgtggaggagagaatgaatggcagtcattttaaagatgaaaaggctttggtg
accagtcaaaattcagacttgctggatgatgaagaagttgaagatgaggtgttgttagat
gaggaggatgaagacaatgatattactggaaaaacaggaaaggaaccagtgacaagtaat
ttacatgaaggaaaccctgaggatgactatgaagaaaccagtgccctggagatgagttgc
aagacatccccagtgaggtataaagaggaagaatataaaagtggactttctgctctagat
catataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcaatattct
gaagctgagctgtcttcttttagtacttcccatgtgccagaggaacttaagcagccgtta
cacagaaagtccaaatcgcaggcatatgctatgatgctgtcactgtctgacaaggagtcc
ctccattctacatcccacagttcttccaacgtgtggcacagtatggccagggctgcggcg
gaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system