KEGG   Homo sapiens (human): 214Help
Entry
214               CDS       T01001                                 

Gene name
ALCAM, CD166, MEMD
Definition
(RefSeq) activated leukocyte cell adhesion molecule
  KO
K06547  
activated leukocyte cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    214 (ALCAM)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    ALCAM; activated leukocyte cell adhesion molecule [KO:K06547]
     214 (ALCAM)
Cellular antigens [BR:hsa04090]
 Proteins
  214 (ALCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.1
AA seq 583 aa AA seqDB search
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDN
VFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPL
EGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVF
DIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaagggggccagttcctgccgtctgctcttctgcctcttgatctccgccacc
gtcttcaggccaggccttggatggtatactgtaaattcagcatatggagataccattatc
ataccttgccgacttgacgtacctcagaatctcatgtttggcaaatggaaatatgaaaag
cccgatggctccccagtatttattgccttcagatcctctacaaagaaaagtgtgcagtac
gacgatgtaccagaatacaaagacagattgaacctctcagaaaactacactttgtctatc
agtaatgcaaggatcagtgatgaaaagagatttgtgtgcatgctagtaactgaggacaac
gtgtttgaggcacctacaatagtcaaggtgttcaagcaaccatctaaacctgaaattgta
agcaaagcactgtttctcgaaacagagcagctaaaaaagttgggtgactgcatttcagaa
gacagttatccagatggcaatatcacatggtacaggaatggaaaagtgctacatcccctt
gaaggagcggtggtcataatttttaaaaaggaaatggacccagtgactcagctctatacc
atgacttccaccctggagtacaagacaaccaaggctgacatacaaatgccattcacctgc
tcggtgacatattatggaccatctggccagaaaacaattcattctgaacaggcagtattt
gatatttactatcctacagagcaggtgacaatacaagtgctgccaccaaaaaatgccatc
aaagaaggggataacatcactcttaaatgcttagggaatggcaaccctcccccagaggaa
tttttgttttacttaccaggacagcccgaaggaataagaagctcaaatacttacacactg
acggatgtgaggcgcaatgcaacaggagactacaagtgttccctgatagacaaaaaaagc
atgattgcttcaacagccatcacagttcactatttggatttgtccttaaacccaagtgga
gaagtgactagacagattggtgatgccctacccgtgtcatgcacaatatctgctagcagg
aatgcaactgtggtatggatgaaagataacatcaggcttcgatctagcccgtcattttct
agtcttcattatcaggatgctggaaactatgtctgcgaaactgctctgcaggaggttgaa
ggactaaagaaaagagagtcattgactctcattgtagaaggcaaacctcaaataaaaatg
acaaagaaaactgatcccagtggactatctaaaacaataatctgccatgtggaaggtttt
ccaaagccagccattcaatggacaattactggcagtggaagcgtcataaaccaaacagag
gaatctccttatattaatggcaggtattatagtaaaattatcatttcccctgaagagaat
gttacattaacttgcacagcagaaaaccaactggagagaacagtaaactccttgaatgtc
tctgctataagtattccagaacacgatgaggcagacgagataagtgatgaaaacagagaa
aaggtgaatgaccaggcaaaactaattgtgggaatcgttgttggtctcctccttgctgcc
cttgttgctggtgtcgtctactggctgtacatgaagaagtcaaagactgcatcaaaacat
gtaaacaaggacctcggtaatatggaagaaaacaaaaagttagaagaaaacaatcacaaa
actgaagcctaa

DBGET integrated database retrieval system